DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lolal and ZBTB9

DIOPT Version :10

Sequence 1:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_689948.1 Gene:ZBTB9 / 221504 HGNCID:28323 Length:473 Species:Homo sapiens


Alignment Length:120 Identity:38/120 - (31%)
Similarity:64/120 - (53%) Gaps:7/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYF--KALLEENPS-KHPI 71
            :::....::::.|....|.|..|.||:|..:|:..:|||.||:|.||||  |.||.:.|. ..|.
Human    25 IEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPS 89

  Fly    72 IILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETPSSIKRE 126
            :|..|.    .:.:|:.:|:|.:.:..:.|||.|..|..|::..:.:..|.|.||
Human    90 VIEADA----FEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRE 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 31/85 (36%)
ZBTB9NP_689948.1 BTB_POZ_ZBTB9 30..140 CDD:349509 36/113 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..279
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..376
C2H2 Zn finger 388..405 CDD:275368
C2H2 Zn finger 413..433 CDD:275368
zf-C2H2 413..433 CDD:395048
C2H2 Zn finger 440..457 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.