DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cutlet and Rfc1

Sequence 1:NP_787969.1 Gene:cutlet FlyBaseID:FBgn0015376 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_445999.1 Gene:Rfc1 RGDID:620619 Length:1131 Species:Rattus norvegicus

Alignment Length:1089 Identity:240/1090 (22%)
Similarity:373/1090 (34%) Gaps:321/1090 (29%)


  Fly     6 DENEEFELQ-YQDE-----LELLEDLPDEFNA----YDGPSTSKQAAEKQKENRAPVAALRDSTR 60
            ||:.|.|.| ::||     |.||::.|....|    .:|.|.|...||..|      ||.:.|..
  Rat   210 DEDAELERQLHEDEEFARTLALLDEEPKTKKARKDSEEGESFSPAKAELSK------AAKQKSPA 268

  Fly    61 LGNSTLGSPQLSQITFGASQLGGEEEAEGTSSGGQ------------------------------ 95
            ..:.::|....|...:|..: |.|...:...|..|                              
  Rat   269 NEHFSIGRKTYSPAKYGKGR-GSEGTKQPCRSAHQKEACSSLKASSKSALMKAQEENSYKETELL 332

  Fly    96 -VNRRLFGTPKG----PPVGRGCSTPFQRM-PAIQELENTQLTS-RSYGLEKENAAANQLQEV-- 151
             ..|.....|||    |...:|..|..:.: |...|.:.|...: ||| |.:|...|...:|:  
  Rat   333 AAKRESAIEPKGEKTTPRKTKGSPTKRESVSPEDSEKKRTNYQAYRSY-LNREGPKALGSKEIPK 396

  Fly   152 GLKNVNKRRLERDLF---GDIDDLFHESYEDPMVKKARTEEQRDHEAIER--------------I 199
            |.:|.    ||...|   |.::.:               |.:.....|||              .
  Rat   397 GAENC----LEGLTFVITGVLESI---------------EREEAKSLIERYGGKVTGNVSKKTSY 442

  Fly   200 LELRRKMRES---------SKTLRKDDVSRLKALHDFKMRNLSYEIPNWPFLAIQRSDLERIYVR 255
            |.:.|...:|         :|.|.:|.:  |..:.....:...|||.....:..::|.|||..  
  Rat   443 LVMGRDSGQSKSDKAAALGTKILDEDGL--LDLIRTMPGKKSKYEIAAEAEMKKEKSKLERTP-- 503

  Fly   256 FHSEDYEQRQLDLISARGEVVGSLLGEAKD---KIWQEAGEIVLSRATAAEDADVTLVNSNANSE 317
             ...|..:|:|.......|...|.|...|.   |..:|. |.|..|..   ||.....:.:|:.|
  Rat   504 -QKNDQGKRKLSPTKRELEPKKSKLTPLKHSPRKAVKEE-ERVCPRGL---DAKEPHGSHSASRE 563

  Fly   318 PGRLWVDKYKP---RKYIDLLSDEMTNRSLLYWLKMWDKVVFGKAFHSKREQEAVTGEGGTAGGA 379
            ...||||||||   :..|....|:.....||.||:.|.|....:..|:.:..:..:.:.|     
  Rat   564 ECLLWVDKYKPTSLKNIIGQQGDQSCANKLLRWLRNWHKSSPEEKKHAAKFGKVASKDDG----- 623

  Fly   380 ANQLNSFNKRTGKFESNGGWRQRKSRQALNTNVDALGRPMQKVALLCGPPGLGKTTLAHTIARHA 444
                :||                                  |.|||.||||:||||.|..:.:..
  Rat   624 ----SSF----------------------------------KAALLSGPPGVGKTTTASLVCQEL 650

  Fly   445 GYNVREINASDDRSPEAFKLALE---NGTQMSSVLNEDKRP-----NCIVLDEIDG----APRQS 497
            ||:..|:||||.||..:.|..:.   |.|.:.........|     :.:::||:||    ..|..
  Rat   651 GYSYVELNASDTRSKNSLKAIVAESLNNTSIKGFYTSGASPSVSARHALIMDEVDGMAGNEDRGG 715

  Fly   498 IDYLVKFISDAVYTKVKAKGAKAEHNVLKRPIICICNDVYDPALRPLRQVAFVVTFPPIDAARLA 562
            |..|:..|.   :||:              ||||:|||...|.:|.|....|.:.|......::.
  Rat   716 IQELIGLIK---HTKI--------------PIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIK 763

  Fly   563 ERLVKIAFKEQLKTDFGSLIALAEKSGNDVRSCISSMQFFNAQKHSLTL-QDVLNNNLGQKDRHQ 626
            ..::.|||||.||....::..:...:..|||..:.::..:.||...||. |...::...:||...
  Rat   764 SAMLSIAFKEGLKIPPPAMNEIILGANQDVRQVLHNLSMWCAQSKVLTYDQAKADSQRAKKDIRL 828

  Fly   627 GLFAVWDAIFRIQRPRKTLHTDANKVDEPAQVTMTNTSVTTRVRNVLEVVHSSGDYERLTQGVYE 691
            |.|.|...:|...             :|.|.:::.:.|..        ..|   ||......|.|
  Rat   829 GPFDVTRKVFAAG-------------EETAHMSLMDKSDL--------FFH---DYSIAPLFVQE 869

  Fly   692 NYLQQKMPDPNFTG---------VCEALKWFCFTDTVQHQISRQQNYSVYP-----------YLQ 736
            |||..|   |...|         :..|....|..|.|.:||..:||:|:.|           .|.
  Rat   870 NYLHVK---PVAAGGDMKKHLMLLSRAADSICDGDLVDNQIRSKQNWSLLPTQAIYASVVPGELM 931

  Fly   737 YGFVAWHLLFATLAWPKIAFPTRGFEFQQKSTNQRNIFQALCKGVTTSALGVGQGGTLLLDTVPL 801
            .|:::        .:|  :||:...:......:.|.: |.|...::             |.|...
  Rat   932 RGYMS--------QFP--SFPSWLGKHSSMGKHDRTV-QDLSLHMS-------------LRTYSS 972

  Fly   802 LKRILSPQLRSVAVQLLSPKEQQDLRHTIEVMVDLGLTFVQVKSQEGHYVFQTEPDLDALSAFPG 866
            .:.:....|..:...|:.|...|.: ..::.:|.|..|:..||.                     
  Rat   973 KRTVNMDYLSHIRDALVRPLTSQGV-EGVQRVVTLMDTYYLVKE--------------------- 1015

  Fly   867 YTGLSLPYFSRQLIAREVDLERIRRAAPKGGAPSA-----PAAKKKTSGA----AAQLPNHLQTL 922
                              |.:.|...:..||.||.     |..|...:.|    |...|..||.:
  Rat  1016 ------------------DFDNIMEVSSWGGKPSTFSKLDPKVKAAFTRAYNKEAHLTPYSLQVV 1062

  Fly   923 K-PKPISASNMHSAPKQQLTKDFFGRITHKSTSTNSAEES--KTDAIVK 968
            | .:|.....:.|...::..:|        :|.::..|:.  :|||::|
  Rat  1063 KASRPSIGPALDSEYNEESQED--------ATQSDEKEQDALETDAMIK 1103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cutletNP_787969.1 AAA 424..555 CDD:99707 46/143 (32%)
Rfc1NP_445999.1 BRCT 404..475 CDD:237994 13/88 (15%)
AAA 630..760 CDD:214640 46/147 (31%)
AAA 630..758 CDD:278434 46/145 (32%)
RFC1 897..1050 CDD:285691 37/217 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D291910at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.