DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cutlet and CTF18

DIOPT Version :8

Sequence 1:NP_787969.1 Gene:cutlet / 44637 FlyBaseID:FBgn0015376 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_013795.1 Gene:CTF18 / 855102 SGDID:S000004683 Length:741 Species:Saccharomyces cerevisiae

Alignment Length:856 Identity:198/857 (23%)
Similarity:333/857 (39%) Gaps:235/857 (27%)


  Fly   240 PFL-AIQRSDLERIYVRFHSEDYEQ---------RQLDL---ISARGEVVGSLLGEAK------- 284
            |:: ::.||.|      |.:.|.||         .:.|:   :|:.||.|......||       
Yeast     6 PYIGSLGRSSL------FDTGDIEQAPGNNAIGINEEDIHAFVSSTGETVQLKKKPAKLATGNIS 64

  Fly   285 -----DKIW-----------------QEAGEIVLSRATAAEDADVT-LVNSNANSEPGRLWVDKY 326
                 |.:|                 :.:|:   .|..|.:.:.:| .:.|:.      |||:|:
Yeast    65 LYTNPDTVWRSDDTYGININYLLDKIEASGD---DRTNAQKTSPITGKIGSDT------LWVEKW 120

  Fly   327 KPRKYIDLLSDEMTNRSLLYWLKMWDKVVFGKAFHSKREQEAVTGEGGTAGGAANQLNSFNKRTG 391
            :|:|::||:.:|.|||.:|.||:.|...||      |.:...:..|                   
Yeast   121 RPKKFLDLVGNEKTNRRMLGWLRQWTPAVF------KEQLPKLPTE------------------- 160

  Fly   392 KFESNGGWRQRKSRQALNTNVDALGRPMQKVALLCGPPGLGKTTLAHTIARHAGYNVREINASDD 456
                         ::..:..:|.|.||.:|:.||.||||:|||::||.||:.:|::|.||||||:
Yeast   161 -------------KEVSDMELDPLKRPPKKILLLHGPPGIGKTSVAHVIAKQSGFSVSEINASDE 212

  Fly   457 RSPEAFKLALENGTQMSSVLNE--DKRPNCIVLDEIDGAPRQSIDYLVKFISDAVYTKVKA---- 515
            |:....|..:.|     .:.|.  |..|.|:|.|||||:....   .::.:.|.:.:.:||    
Yeast   213 RAGPMVKEKIYN-----LLFNHTFDTNPVCLVADEIDGSIESG---FIRILVDIMQSDIKATNKL 269

  Fly   516 ----------KGAKAEHNVLKRPIICICNDVYDPALRPLRQVAFVVTFPPIDAARLAERLVKIAF 570
                      |..|....:|.||||||||::|.|:|..|:....::.........|.|||..|..
Yeast   270 LYGQPDKKDKKRKKKRSKLLTRPIICICNNLYAPSLEKLKPFCEIIAVKRPSDTTLLERLNLICH 334

  Fly   571 KEQLKTDFGSLIALAEKSGNDVRSCISSMQFF----NAQKHSLTLQDVLNNNL---GQKDRHQGL 628
            ||.:.....::..|.:.:..|||:||:::||.    :::..|.:.:.....|.   ..||.....
Yeast   335 KENMNIPIKAINDLIDLAQGDVRNCINNLQFLASNVDSRDSSASDKPACAKNTWASSNKDSPISW 399

  Fly   629 FAVWDAIFRIQRPRKTLHTDANKVDEPAQVTMTNTSVTTRVRNVLEVVHSSGDYERLTQGVYENY 693
            |.:.:.:|     ||..|.|                :..:...:|..|..:|:.:|:.||.:..:
Yeast   400 FKIVNQLF-----RKDPHRD----------------IKEQFYELLNQVELNGNSDRILQGCFNIF 443

  Fly   694 LQQKMPDPNFTGVCEALKWFCFTDTVQHQISRQQNYSVYPYLQYGFVAWHLLFATLAWPKIAFPT 758
            ...|..|...........|..|     |.:..|..|:....|        |.::.|. |.:.|.|
Yeast   444 PYVKYSDNGIRKPANISDWLFF-----HDLMYQSMYAHNGEL--------LRYSALV-PLVFFQT 494

  Fly   759 RG------------FEFQQKSTNQRN--IFQALCKGVTTSA---LGVGQGGTLLLDTVPLLKRIL 806
            .|            .|::|:...:.|  |...:.:.::..:   .......:|:.:.:|.|..::
Yeast   495 FGDIANKDDIRMKNSEYEQRELKRANSDIVSLIMRHISVQSPLMASFTDRKSLIFEILPYLDSMI 559

  Fly   807 SPQLRSVAVQLLSPKEQQDLRHTIEVMVDLGLTFVQVKSQEGHYV---FQTEPDLDALSAF-PGY 867
            |.....:....|   :|..:...::::....|..:|.:| ||..|   ...:|.:|.:... |.:
Yeast   560 SSDFNKIRNLKL---KQAIMEELVQLLKSFQLNLIQNRS-EGFDVRGGLTIDPPIDEVVLLNPKH 620

  Fly   868 TGLSLPYFSRQLIAREVDLERIRRAAPKGGAPSAPAAKKKTSGAAAQLPNHLQTLKPKPISASNM 932
                         ..||..:|....:..........|||:          |:..:....:.:..|
Yeast   621 -------------INEVQHKRANNLSSLLAKIEENRAKKR----------HIDQVTEDRLQSQEM 662

  Fly   933 HSAP------KQQLTKDFF----GRI--------THK---STSTNSAEESKTDAIVKSPIWYRYK 976
            ||..      ....|.|||    |.:        |.|   |..||.|::  .:..||  ||.:|.
Yeast   663 HSKKVKTGLNSSSSTIDFFKNQYGLLKQTQELEETQKTIGSDETNQADD--CNQTVK--IWVKYN 723

  Fly   977 EGFNNAVRKDV 987
            |||:|||||:|
Yeast   724 EGFSNAVRKNV 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cutletNP_787969.1 AAA 424..555 CDD:99707 52/147 (35%)
CTF18NP_013795.1 RuvB_N 116..>422 CDD:330522 101/373 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C335303414
eggNOG 1 0.900 E1_KOG1969
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1044
Isobase 1 0.950 0 Normalized mean entropy S4279
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003909
OrthoInspector 1 1.000 T1135993
orthoMCL 1 0.900 OOG5_128937
Panther 1 1.100 LDO PTHR23389
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R259
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.