DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cutlet and RFC1

Sequence 1:NP_787969.1 Gene:cutlet FlyBaseID:FBgn0015376 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001191676.1 Gene:RFC1 HGNCID:9969 Length:1148 Species:Homo sapiens

Alignment Length:1079 Identity:226/1080 (21%)
Similarity:373/1080 (35%) Gaps:344/1080 (32%)


  Fly     3 QYPDENEEFELQYQDELELLED-------LPDEFNAYDGP-STSKQAAEKQKENRA-----PVAA 54
            |..||.:.:..:.|.:.|..::       ..|:......| ::||.|..|:||..:     |||:
Human   274 QVSDERKSYSPRKQSKYESSKESQQHSKSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVAS 338

  Fly    55 --------LRDSTRLGNSTLGSPQLSQITFGASQLGGEEEAEGTSSGGQVNR--------RLFGT 103
                    |:..|:....|..||...:..       ..|::|...:..|..|        :..|:
Human   339 KRKENAIKLKGETKTPKKTKSSPAKKESV-------SPEDSEKKRTNYQAYRSYLNREGPKALGS 396

  Fly   104 ---PKGPP--------VGRGCSTPFQRMPA--------------IQELENTQLTSRSYGLEKENA 143
               |||..        |..|.....:|..|              :.:..|..:..|..|..|.:.
Human   397 KEIPKGAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDK 461

  Fly   144 AA----NQLQEVGLKNVNKRRLERDLFGDIDDLFHESYEDPMVKKARTEE--QRDHEAIERILEL 202
            ||    ..:.|.||.|     |.|.:.|. ...:..:.|..|.|:::.|.  |::.:. :|.:..
Human   462 AAALGTKIIDEDGLLN-----LIRTMPGK-KSKYEIAVETEMKKESKLERTPQKNVQG-KRKISP 519

  Fly   203 RRKMRESSK---TLRKDDVSR-LKALHDFKMRNLSYEIPNWPFLAIQRSDLERIYVRFHSEDYEQ 263
            .:|..||.|   |.::|.::: :|...|...::|.:                             
Human   520 SKKESESKKSRPTSKRDSLAKTIKKETDVFWKSLDF----------------------------- 555

  Fly   264 RQLDLISARGEVVGSLLGEAKDKIWQEAGEIVLSRATAAEDADVTLVNSNANSEPGRLWVDKYKP 328
                    :.:|.....|::|.:             ..|:|       |:.|.....||||||||
Human   556 --------KEQVAEETSGDSKAR-------------NLADD-------SSENKVENLLWVDKYKP 592

  Fly   329 ---RKYIDLLSDEMTNRSLLYWLKMWDKVVFGKAFHSKREQEAVTGEGGTAGGAANQLNSFNKRT 390
               :..|....|:.....||.||:.|.|.......|:.:                     |.|.:
Human   593 TSLKTIIGQQGDQSCANKLLRWLRNWQKSSSEDKKHAAK---------------------FGKFS 636

  Fly   391 GKFESNGGWRQRKSRQALNTNVDALGRPMQKVALLCGPPGLGKTTLAHTIARHAGYNVREINASD 455
            ||.:.:.                      .|.|||.||||:||||.|..:.:..||:..|:||||
Human   637 GKDDGSS----------------------FKAALLSGPPGVGKTTTASLVCQELGYSYVELNASD 679

  Fly   456 DRSPEAFKL----ALEN----GTQMSSVLNEDKRPNCIVLDEIDG----APRQSIDYLVKFISDA 508
            .||..:.|.    :|.|    |...:...:.....:.:::||:||    ..|..|..|:..|.  
Human   680 TRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMDEVDGMAGNEDRGGIQELIGLIK-- 742

  Fly   509 VYTKVKAKGAKAEHNVLKRPIICICNDVYDPALRPLRQVAFVVTFPPIDAARLAERLVKIAFKEQ 573
             :||:              ||||:|||...|.:|.|....|.:.|......::...::.|||||.
Human   743 -HTKI--------------PIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEG 792

  Fly   574 LKTDFGSLIALAEKSGNDVRSCISSMQFFNAQKHSLTL-QDVLNNNLGQKDRHQGLFAVWDAIFR 637
            ||....::..:...:..|:|..:.::..:.|:..:||. |...:::..:||...|.|.|      
Human   793 LKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRAKKDIKMGPFDV------ 851

  Fly   638 IQRPRKTLHTDANKV----DEPAQVTMTNTSVTTRVRNVLEVVHSSGDYERLTQGVYENYLQQKM 698
                       |.||    :|.|.:::.:.|..        ..|   ||......|.|||:..| 
Human   852 -----------ARKVFAAGEETAHMSLVDKSDL--------FFH---DYSIAPLFVQENYIHVK- 893

  Fly   699 PDPNFTG---------VCEALKWFCFTDTVQHQISRQQNYSVYP-----------YLQYGFVAWH 743
              |...|         :..|....|..|.|..||..:||:|:.|           .|..|::.  
Human   894 --PVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMT-- 954

  Fly   744 LLFATLAWPKIAFPT-RGFEFQQKSTNQRN-IFQALCKGVTTSALGVGQGGTLLLDTVPLLKRIL 806
                       .||| ..:..:..||.:.: |.|.|  .:..|........|:.:|.:.||:..|
Human   955 -----------QFPTFPSWLGKHSSTGKHDRIVQDL--ALHMSLRTYSSKRTVNMDYLSLLRDAL 1006

  Fly   807 SPQLRSVAVQLLSPKEQQDLRHTIEVMVDLGLTFVQVKSQEGHYVFQTEPDLDALSAFPGYTGLS 871
                                   ::.:...|:..||                |.::....|    
Human  1007 -----------------------VQPLTSQGVDGVQ----------------DVVALMDTY---- 1028

  Fly   872 LPYFSRQLIAREVDLERIRRAAPKGGAPSAPAAK--KKTSGAAAQLPN---HLQTLKPKPISASN 931
              |..::      |.|.|...:..||.|| |.:|  .|...|..:..|   ||.....:.|.||.
Human  1029 --YLMKE------DFENIMEISSWGGKPS-PFSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASR 1084

  Fly   932 MHSAPKQQLTKDFFGRITHKSTSTNSAEES--KTDAIVK 968
            ..::|  .|..::...:....:.::..::.  :|||::|
Human  1085 HSTSP--SLDSEYNEELNEDDSQSDEKDQDAIETDAMIK 1121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cutletNP_787969.1 AAA 424..555 CDD:99707 46/143 (32%)
RFC1NP_001191676.1 Neuromodulin_N <14..404 CDD:331332 29/137 (21%)
COG5275 272..502 CDD:227600 49/241 (20%)
LIGANc <392..479 CDD:332121 19/92 (21%)
RuvB_N 584..>1003 CDD:330522 128/525 (24%)
RFC1 915..1067 CDD:312129 42/219 (19%)
Nuclear localization signal. {ECO:0000255} 1120..1124 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D291910at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.