DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: cutlet and Gnf1

Sequence 1:NP_787969.1 Gene:cutlet FlyBaseID:FBgn0015376 Length:993 Species:Drosophila melanogaster
Sequence 2:NP_001014605.1 Gene:Gnf1 FlyBaseID:FBgn0004913 Length:1008 Species:Drosophila melanogaster

Alignment Length:1126 Identity:219/1127 (19%)
Similarity:362/1127 (32%) Gaps:407/1127 (36%)


  Fly     7 ENEEFE--LQYQDELELLEDLPDEFNAYDGPSTSKQAAEKQKENRAPVAALRDSTRLGNSTLGSP 69
            |||:.:  |...|..|.:::...|...:.  .|....:.|:.:|.:|......||:   |...:|
  Fly   121 ENEDIDRSLMEVDLDESIKEAAPEKKVHS--ITRSSPSPKRAKNSSPEPPKPKSTK---SKATTP 180

  Fly    70 QLSQ----ITFGASQLGGEEEAEGTSSGGQVNRRLFG-----------TPKGPPVGRGC--STPF 117
            ::.:    ....:|.|..||..|...:...:.::...           .|||.|   .|  ...|
  Fly   181 RVKKEKPAADLESSVLTDEERHERKRASAVLYQKYKNRSSCLNPGSKEIPKGSP---DCLSGLTF 242

  Fly   118 QRMPAIQELENTQLTS--RSYGLEKENAAANQL------QEVGLK------NVNKRRLERDLFGD 168
            .....::.:|..:..|  :.||.:.......:|      :|.|.|      .:|...|..|  |.
  Fly   243 VVTGVLESMEREEAESVIKEYGGKVMTVVGKKLKYLVVGEEAGPKKLAVAEELNIPILSED--GL 305

  Fly   169 IDDLFHESYEDPMVKKARTEEQRDHEAIER-ILELRRKMRESSKTLRKDDVSRLK--ALHDFKMR 230
            .|.:..:|.....||:.:...:::|.:.|: ..|::...|.|.|  ::.:.::||  ..||....
  Fly   306 FDLIREKSGIAKQVKEEKKSPKKEHSSEEKGKKEVKTSRRSSDK--KEKEATKLKYGEKHDIAKH 368

  Fly   231 NLSYEIPNWPFLAIQRSDLERIYVRFHSEDYEQRQLDLISARGEVVGSLLGEAKDKIWQEAGEIV 295
            .:..|                     |:..                    .|.|||:        
  Fly   369 KVKEE---------------------HTSP--------------------KETKDKL-------- 384

  Fly   296 LSRATAAEDADVTLVNSNANSEP---------------------GRLWVDKYKPRKYIDLL---- 335
                     .||..|......||                     |..||||:||....:::    
  Fly   385 ---------NDVPAVTLKVKKEPSSQKEHPPSPRTADLKTLDVVGMAWVDKHKPTSIKEIVGQAG 440

  Fly   336 -SDEMTNRS--------------------LLYWLKMWDKVVFGKAFHSKREQEAVTGEGGTAGGA 379
             :..:||.:                    |:.||..|                .|..:|      
  Fly   441 AASNVTNHNLKLKAKQERVKVLHYFNFPRLMNWLSKW----------------YVNHDG------ 483

  Fly   380 ANQLNSFNKRTGKFESNGGWRQRKSRQALNTNVDALGRPMQKVALLCGPPGLGKTTLAHTIARHA 444
                   ||:.          ||.:..|.|.:     ....|.|||.||||:||||.|..:.:..
  Fly   484 -------NKKP----------QRPNPWAKNDD-----GSFYKAALLSGPPGIGKTTTATLVVKEL 526

  Fly   445 GYNVREINASDDRSPEAFKLALENGTQMSSVLNED-------------KRPNCIVLDEIDG---- 492
            |::..|.||||.||....|      .::|::|:..             .|.:.:::||:||    
  Fly   527 GFDAVEFNASDTRSKRLLK------DEVSTLLSNKSLSGYFTGQGQAVSRKHVLIMDEVDGMAGN 585

  Fly   493 APRQSIDYLVKFISDAVYTKVKAKGAKAEHNVLKRPIICICNDVYDPALRPLRQVAFVVTFPPID 557
            ..|..:..|:..|.|:                 ..||||:|||...|.:|.|....:.:.|....
  Fly   586 EDRGGMQELIALIKDS-----------------SIPIICMCNDRNHPKIRSLVNYCYDLRFQRPR 633

  Fly   558 AARLAERLVKIAFKEQLKTDFGSLIALAEKSGNDVRSCISSMQFFNAQKHSLTLQDVLNNNLGQ- 621
            ..::..:::.|.|||::|.....:..:...:.||:|..|:.:...:|::.:       :...|| 
  Fly   634 LEQIKGKIMSICFKEKVKISPAKVEEIIAATNNDIRQSINHIALLSAKEDA-------SQKSGQQ 691

  Fly   622 ---KDRHQGLFAVWDAIFRIQRPRKTLHTDANKVDEPAQVTMTNTSVTTRVRNVLEVVHSS---- 679
               ||...|   .|:.:      ||....|.:|                         |.|    
  Fly   692 VATKDLKLG---PWEVV------RKVFTADEHK-------------------------HMSFADK 722

  Fly   680 -----GDYERLTQGVYENYLQQKMPDPN-------FTGVCEALKWFCFTDTVQHQISRQQNYSVY 732
                 .||......|.:||| |.:|..|       .....:||.   ..|.|:.:|....     
  Fly   723 SDLFFHDYSLAPLFVQQNYL-QVLPQGNKKDVLAKVAATADALS---LGDLVEKRIRANS----- 778

  Fly   733 PYLQYGFVAWHLL----FATLAWP----------KIAFPTRGF-EFQQKSTNQRNIFQAL--CKG 780
                    ||.||    |.:...|          :|.||  |: ....||..:..:.|.|  ...
  Fly   779 --------AWSLLPTQAFFSSVLPGEHMCGHFTGQINFP--GWLGKNSKSGKRARLAQELHDHTR 833

  Fly   781 VTTSALGVGQGGTLLLDTVP-LLKRILSPQLRSVAVQLLSPKEQQDLRHTIEVMVDLGLTFVQVK 844
            |.||    |...::.||..| ||..|:.|         |:...|:.:...::||.|..|      
  Fly   834 VCTS----GSRLSVRLDYAPFLLDNIVRP---------LAKDGQEGVPAALDVMKDYHL------ 879

  Fly   845 SQEGHYVFQTEPDLDALSAFPGYTGLSLPY--------------FSRQLIAREVDLERIRRAAPK 895
                     ...|||:|.....:.|...|.              ::::::|.....:        
  Fly   880 ---------LREDLDSLVELTSWPGKKSPLDAVDGRVKAALTRSYNKEVMAYSYSAQ-------- 927

  Fly   896 GGAPSAPAAKKKTSGAAAQ-------------LPNHLQTLKPKP---ISASNMHSAPKQQLTKDF 944
                 |...|||:..|.|.             ...||.:.:.:.   :...::..|.|:..|...
  Fly   928 -----AGIKKKKSEAAGADDDYLDEGPGEEDGAGGHLSSEEDEDKDNLELDSLIKAKKRTTTSKA 987

  Fly   945 FGRITHKSTSTNSAEESKTDA 965
            .|  ..|..::::|.:||..|
  Fly   988 SG--GSKKATSSTASKSKAKA 1006

Known Domains:


GeneSequenceDomainRegion External IDIdentity
cutletNP_787969.1 AAA 424..555 CDD:99707 42/148 (28%)
Gnf1NP_001014605.1 COG5275 <151..358 CDD:227600 42/217 (19%)
BRCT 232..309 CDD:278934 17/82 (21%)
PRK04195 421..969 CDD:235250 146/716 (20%)
AAA 506..633 CDD:278434 42/150 (28%)
RFC1 764..917 CDD:285691 41/199 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23389
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.