DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and smyd4

DIOPT Version :8

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001070062.1 Gene:smyd4 / 767654 ZFINID:ZDB-GENE-060929-248 Length:753 Species:Danio rerio

Alignment Length:595 Identity:126/595 - (21%)
Similarity:206/595 - (34%) Gaps:197/595 - (33%)


  Fly     5 TVGSSRSATTSATASACSSKSKNL----KNPAPQIKRGQRILTEKPFAFVL-------------K 52
            ||.|:...:...:....|.|.:::    ..||     |:.:|.::.:..||             .
Zfish   177 TVNSTGHLSDGVSVYFSSDKGRHMLVMENKPA-----GEVVLEDEAYCSVLIPANIFNTGTNKAV 236

  Fly    53 SQYRLE--RCDNCL-EATKVLKCSNCRYVSYCHRSCQMQAWGQ-HKHECPFLKKVHPRVVPD--A 111
            ..:..|  .|.:|| ::...:.|..|.|..||..|||..||.| |:.|||        |..|  |
Zfish   237 ETFGTEDRHCHHCLSQSLSFVPCPKCSYARYCGESCQKDAWDQWHQWECP--------VGADLLA 293

  Fly   112 ARMLCRLILRLEHGGDLIRGYYTE--HGSRKFRDLMSHYAEIKND-PMR----------LEHLDS 163
            ..:|..|.||:     :::...||  .|.:..:|   |....||| |::          |:|.|.
Zfish   294 IGVLGHLALRV-----VLKAGQTEVQMGIKNTKD---HVTTYKNDSPVQLSLGGDCGKSLDHTDC 350

  Fly   164 LH--------AVLTDMMAESPST-------------------VPNK-------------TELMSI 188
            .|        ::|..:...||::                   .|||             ...||:
Zfish   351 FHGSSYMGIYSLLPHVAQHSPASRFLMAITMAVIYGKLQGGPPPNKWMSFKDEGVKASWQPEMSM 415

  Fly   189 YG--------------RLIT-------NGFNILDAEMNSIATAIYLGVSITDHSCQPNAVATF-- 230
            .|              :.||       :|..:..:....|||||:..:|:.:|||.||...:|  
Zfish   416 LGATALRHMMQLRCNAQAITAVRVKEESGMAVQSSSEIRIATAIFPVLSLLNHSCSPNTSISFTT 480

  Fly   231 -------------EGNELH-----------VHAIEDMECLDWSKIFISYIDLLNTPEQRRLDLK- 270
                         ||:..|           |.|.:|:..  ..:|...|     .|.:.|:::| 
Zfish   481 GFQPDPHNQLGCSEGHFDHPKGSRSGVTVTVRASKDLTA--GQEILHCY-----GPHRSRMEVKE 538

  Fly   271 ------EHYYFLCVCSKC-TDAKE----SKEMLAA------------------LCPNRNCGAGIS 306
                  |.|:|.|||..| .|..|    :||..|.                  .|...:||..||
Zfish   539 RQRLLLEQYFFQCVCQACQRDLSEGSPNAKEHTAPGMKCVKCGKPLQSHTDGYTCSWSSCGHQIS 603

  Fly   307 VDRNNCPRCDAGISPKLRN---AFNEAMTLTRHNLENMKDVAYLDVCKVCLDKQTGVFHPLNVWY 368
                     .|.:..:|:.   ..:||:    |.:|..:....|.:.:....:...:....:.:.
Zfish   604 ---------SADVQNRLQGFQLLLDEAV----HLMEQDRLNEALHILQSAFSQANSILTETHPFQ 655

  Fly   369 VKTLDAAFEAAIEVGKWSDALDYGQRLLPGFRKYHGPWNPLLGLLHMKLGKIQLYEGHSKEALHH 433
            .:..||........|:||.|..:.:|.|...:...|..:..||....||.::.........:|..
Zfish   656 GELADALARLYASTGEWSLAASHLKRSLVAIQAQFGEDSIELGRQLFKLAQLHFNGRDGVASLSV 720

  Fly   434 LEEAQRILTV 443
            :..|:|:|::
Zfish   721 IPRARRLLSL 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 15/38 (39%)
TPR_12 377..440 CDD:290160 13/62 (21%)
smyd4NP_001070062.1 TPR_11 68..134 CDD:290150
TPR repeat 68..96 CDD:276809
TPR repeat 101..134 CDD:276809
zf-MYND 246..285 CDD:280009 15/38 (39%)
SET <456..532 CDD:214614 20/82 (24%)
T6SS_VasJ <603..679 CDD:299836 14/88 (16%)
TPR_12 615..683 CDD:290160 12/71 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56173866
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.