DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd3 and SMYD3

Sequence 1:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001161212.1 Gene:SMYD3 HGNCID:15513 Length:428 Species:Homo sapiens

Alignment Length:447 Identity:129/448 (29%)
Similarity:211/448 (47%) Gaps:45/448 (10%)


  Fly    20 ACSSKSKNLKNPAPQIKRGQRILTEKPFAFVLKSQYRLERCDNC-LEATKVLKCSNCRYVSYCHR 83
            |.:.:...|:...| ::.|:.:....|.|:.:....|...||.| |...|:::||.||...||..
Human    10 ATAKRGNGLRAVTP-LRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSA 73

  Fly    84 SCQMQAWGQHKHECPFLKKVHPRVVPDAARMLCRLILRLEHGGDLIRGYYTEHGSRK---FRDLM 145
            .||.:||..||.||..||...||..||:.|:|.|::.:|..|        ....|.|   |.||.
Human    74 KCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDG--------APSESEKLYSFYDLE 130

  Fly   146 SHYAEIKNDPMRLEHLDSLHAVLTDMMAE---SPSTVPNKTELMSIYGRLITNGFNILDAEMNSI 207
            |:..::..|  :.|.|..|.......|.|   ..|.:|...:|...:.::|.|.|.|.:|||..:
Human   131 SNINKLTED--KKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEV 193

  Fly   208 ATAIYLGVSITDHSCQPNAVATFEGNELHVHAIEDMECLDWSKIFISYIDLLNTPEQRRLDLKEH 272
            ...:|..:|:.:|||.||....|.|..|.:.|:.|:|.  ..::.|.|:|:|.|.|:||..|::.
Human   194 GVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEV--GEELTICYLDMLMTSEERRKQLRDQ 256

  Fly   273 YYFLCVCSKCTDAKESKEMLAALCPNRNCGAGISVDRNNCPRCDAGISPKLRNAFNEAMTLTRHN 337
            |.|.|.|.:|....:..:||..                     |..:..:::.:..:...|..| 
Human   257 YCFECDCFRCQTQDKDADMLTG---------------------DEQVWKEVQESLKKIEELKAH- 299

  Fly   338 LENMKDVAYLDVCKVCLDKQTGVFHPLNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPGFRKY 402
               .|....|.:|:..:...:.....:|::.:|.||.|.:|.|.:|...:||.||.|.:..:|.:
Human   300 ---WKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIF 361

  Fly   403 HGPWNPLLGLLHMKLGKIQLYEGHSKEALHHLEEAQRILTVTHGRDHRLLTEQLYML 459
            ....:|:.|:..||:||:||::|...:|:.:|..|..|:.|||||:|.|:.:.:.:|
Human   362 FPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLL 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 18/38 (47%)
TPR_12 377..440 CDD:290160 21/63 (33%)
SMYD3NP_001161212.1 S-adenosyl-L-methionine binding. {ECO:0000269|Ref.12} 14..16 0/2 (0%)
zf-MYND 49..87 CDD:280009 18/38 (47%)
SET <201..239 CDD:279228 13/40 (33%)
S-adenosyl-L-methionine binding. {ECO:0000269|Ref.12} 205..206 0/1 (0%)
C-terminal domain, essential for histone methyltransferase activity, nuclear localization and mediates interaction with HSP90AA1. {ECO:0000269|PubMed:25738358} 272..428 43/173 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56379293
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 1 1.000
Homologene 1 1.000 H41491
Inparanoid 1 1.050 201 1.000 Inparanoid score I3706
Isobase 1 0.950 0 Normalized mean entropy S4564
OMA 1 1.010
OrthoDB 1 1.010 D553549at33208
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 1 1.000 T610363
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12197
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2289
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.850

Return to query results.
Submit another query.