DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd3 and Smyd4-1

Sequence 1:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_610500.2 Gene:Smyd4-1 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster

Alignment Length:470 Identity:113/471 (24%)
Similarity:166/471 (35%) Gaps:159/471 (34%)


  Fly    28 LKNPAPQ---------IKRGQRILTEKPFAFVLKSQYRLERCDNCLEATKV---LKCSNC-RYVS 79
            |.:|.|:         |.:|..|.:|:...||...|..:  |..| .||.:   :.|.|| :.|.
  Fly   219 LTDPGPRGRYMVAKEAISKGNVIFSERASCFVPLEQLLI--CQQC-AATLMSAPIPCPNCHQRVV 280

  Fly    80 YCHRSCQMQAWGQHKHECPFLKKVHPRVVPDAARML--CRLILRLEHGGDL------IRGYYTEH 136
            ||.|.|:......||.||...:|       |..|:|  ..|.|||     |      ||.:..|.
  Fly   281 YCSRKCREAHSAIHKFECAAYRK-------DILRLLGISHLALRL-----LLTYIPYIRPHLQEM 333

  Fly   137 GSRK-----FRDLMSHYAEIKNDPMRLEHLDSL------------------------------HA 166
            .|.|     ..:|.....|.:|.|   |:|.||                              |.
  Fly   334 TSAKGMWEEIMNLSRKPEESENAP---EYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHT 395

  Fly   167 VLTDMMAESPSTVPN-----KTELMSIYGRLITNG---------------FNILDAEM------- 204
            ...|.....|:::.:     ...::...|:|:.||               |.:|..|:       
  Fly   396 DFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHL 460

  Fly   205 ----------NSIATAIYLG-VSITDHSCQPNAVATFEGNELHVHAIEDMECLDWSKIFISY-ID 257
                      :...|||.|. :|:.:|:|:|:....|:|..:..:|.:|:  |:..:||..| :|
  Fly   461 KRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDI--LEGEEIFNCYTMD 523

  Fly   258 LLNTPE-QRRLDLKEHYYFLCVCSKCTDAKESKEMLAALCPNRNCGAGISVDRNNC--PRCDAGI 319
            ..|:.: ||...||..|.|.|.|:|||...          |::|.   :|..|..|  |.|....
  Fly   524 YRNSLKLQRSHPLKAIYKFECTCAKCTRTD----------PDQNY---LSFHRYRCEKPNCRQEF 575

  Fly   320 SPKLRNAFNEAMTLTRHNLENMKDVAYLDVCKVCLDKQTGVFHPLN--VWYVKTL---------- 372
            .|..:...|......|.|.|  |.:    .|.||        |.|.  .||.:.|          
  Fly   576 LPDAKVQQNNLRWWLRCNAE--KPI----TCTVC--------HELQHFAWYNEFLGLIGSSADSS 626

  Fly   373 --DAAFEAAIEVGKW 385
              .|.|:|..::.||
  Fly   627 KRQALFKAFDDLDKW 641

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 15/41 (37%)
TPR_12 377..440 CDD:290160 3/10 (30%)
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 15/41 (37%)
SET <447..526 CDD:214614 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5081667
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.