DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd3 and SmydA-3

DIOPT Version :8

Sequence 1:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster

Alignment Length:475 Identity:109/476 (23%)
Similarity:169/476 (36%) Gaps:111/476 (23%)


  Fly    37 RGQRILTEK-PFAFVLKSQYRLERCDNCLEAT---KVLKCSNCRYVSYCHRSCQMQAWGQH-KHE 96
            ||..:|.|: |||...|....:. |..|.|..   :...||.|.: ..| ..|..||...| :.|
  Fly    31 RGHGLLIEELPFAVGPKCNGPVV-CLGCYEPNPDPEEELCSECGW-PLC-VECAQQADNAHFRLE 92

  Fly    97 CPFLKKVHPRV--VPDAAR----MLCRLILRLEHGGDLIRGYYTEHGSRKFRDLMSHYAEIKNDP 155
            |..||....|.  :|..:|    :.|.:.||:.    |.:....|....:... |.|:.|.:...
  Fly    93 CSQLKDARARFFRLPSGSRHCPQLDCIMPLRVL----LAKEANPERWDNEVAP-MEHHKEERQRD 152

  Fly   156 MRLEHLDSLHAVLTDMMAESPSTVPNKTE---LMSIYGRLITNGFNILDAEMNSIATAI-YLGVS 216
            ..:.|.|.::..   .....|..:.|:..   :|.:.|.|..|.|.....:...:.... |.|  
  Fly   153 ADVWHADRVNIA---QYLRGPCQLANRFSEELIMQVVGVLEVNAFEARSPKGYPLRCLFPYTG-- 212

  Fly   217 ITDHSCQPN---AVATFEGNELHVHAIEDMECLDWSKIFISYIDLLNTPEQRRLDLKEHYYFLCV 278
            |..|:|.||   ::...||.::.:.|:.|:|  :...:..||...|:...||:..||:..:|.|.
  Fly   213 ILAHNCVPNTSRSIYPSEGYKIRLRAMVDLE--EGQPLHHSYTYTLDGTAQRQKHLKQGKFFTCQ 275

  Fly   279 CSKCTDAKESKEMLAAL-CPNRNCGAGISVDRN--------NCPRCDAGIS--------PKLRNA 326
            |.:|.|..|.....::| |  ..|..|..|.|.        ||..|.:..|        ..|::.
  Fly   276 CERCLDPTELGTHFSSLKC--GQCAEGFQVPRQPTEPDTSWNCANCGSDTSNADALAMLQSLQSE 338

  Fly   327 FN--EAMTLTRHNLENMKDVAYLDVCKVCLDKQTGVFHPLNVWYVKTLDAAFEAAIEVGKWSDAL 389
            .|  :|:.:....||.::.:         |.|...:.|||:  ::.|                  
  Fly   339 VNAVQALPMAAKRLEEIERL---------LRKYKSLLHPLH--FIAT------------------ 374

  Fly   390 DYGQRLLPGFRKYHGPWNPLLGLLHMKLGKIQLYE-----GHSKEALHHL-EEAQRILTVTHGRD 448
                    |.|:          ||....|::|.||     .|..|....| .:..|:|.......
  Fly   375 --------GLRQ----------LLIEMYGRVQGYEMVQLPDHQLERKAELCRQVLRVLNTFEPGL 421

  Fly   449 HRLLTEQLY----MLVLQAR 464
            .|.....||    .|||.|:
  Fly   422 SRTRAMNLYELHVPLVLLAK 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 12/41 (29%)
TPR_12 377..440 CDD:290160 12/69 (17%)
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D981799at2759
OrthoFinder 1 1.000 FOG0000247
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.