DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd3 and set6

Sequence 1:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_596514.1 Gene:set6 PomBaseID:SPBP8B7.07c Length:483 Species:Schizosaccharomyces pombe

Alignment Length:424 Identity:90/425 (21%)
Similarity:156/425 (37%) Gaps:123/425 (29%)


  Fly    38 GQRILTEKPFAFVLKSQYRLERCDNCL-EATKVLKCSNCRYVSYCHRSCQMQAWGQHKHECPFLK 101
            |:.|:.::.....|.|......|..|. |..|..:|:.|:.:.||.:.||...|..||.||..|:
pombe    27 GKIIIRKRVDILSLDSANLTRTCSTCTEEKVKTQRCAACKIIHYCSKGCQKADWPFHKLECKALQ 91

  Fly   102 KVHPR-VVPDAARMLCRLILRLEHGGDLI---RGYYTEHGSRKFRDLMSHYAEIKNDPMRLEHLD 162
            ..... ::|...|:|.||.|..:....:|   .|:..|     |:.:.|.:::.:.......|..
pombe    92 ASKQNGILPSVCRLLIRLYLLWQKNPAIIEPMEGHQNE-----FQAVSSSWSDAELIASAASHYT 151

  Fly   163 SLHAVLTDMMAESPSTVPNKTEL-MSIYGRLITNGFNILDAEMNSIATAIYLGVSITDHSCQPNA 226
            .::                :.|| ..::.||..|..|::.:..:|:...:...:...:|||.||.
pombe   152 QIY----------------QAELFQKLFCRLAVNAMNLVTSSFDSLGMCLDTILCRLNHSCDPNC 200

  Fly   227 VATFEGNELHVHAIEDMECLDWSKIFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAKESKEM 291
            ...|:|..:.:.:..|::  ...::||||||:......|:..|.:.|:|.|.|.:|.:...:||.
pombe   201 QIIFDGAIVQLVSKRDIK--KDEQLFISYIDIRLPKSIRQKQLLKKYFFSCYCPRCENDHTTKET 263

  Fly   292 LAALCPNRNCGAGISVDRNNCPRCDAGISPKLRNAFNEAMTLTRHNLENMKDVAYLDVCKVCLDK 356
            ..:....|                       |||    :.:|.: ||...:|:            
pombe   264 DGSKWMGR-----------------------LRN----SKSLMK-NLAMARDL------------ 288

  Fly   357 QTGVFHPLNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPGFRKYHGPWNPLLGLLHMKLGKIQ 421
                                        ||          .|:::...||:.||.  |:|||.:.
pombe   289 ----------------------------WS----------CGWKQTAFPWSNLLH--HIKLGMLD 313

  Fly   422 ----------LYEGHSK----EALHHLEEAQRIL 441
                      ||...|.    :|||.::|.|.:|
pombe   314 ESNFNGAFAALYLKSSADEFLDALHVVDEYQLLL 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 14/38 (37%)
TPR_12 377..440 CDD:290160 19/77 (25%)
set6NP_596514.1 SET 5..483 CDD:225491 90/425 (21%)
zf-MYND 49..87 CDD:280009 14/38 (37%)
SET <142..227 CDD:279228 19/103 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41491
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 1 1.000 T1125972
orthoMCL 1 0.900 OOG5_128877
Panther 1 1.100 LDO PTHR12197
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2289
TreeFam 1 0.960
76.990

Return to query results.
Submit another query.