DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd3 and set-18

Sequence 1:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_871849.1 Gene:set-18 WormBaseID:WBGene00044070 Length:507 Species:Caenorhabditis elegans

Alignment Length:489 Identity:128/490 (26%)
Similarity:194/490 (40%) Gaps:110/490 (22%)


  Fly    24 KSKNL-KNPAPQIKRGQ------RI-LTEKPFAFVLKSQYRLERCDNCLE----ATKVLKCSNCR 76
            |:||: |...|.:::.:      || :.|.|||..:.:....|.|.|||.    ..|:|:|..|.
 Worm     5 KNKNVPKQEDPLVQKDEISSIHARIKIFETPFATQVLNPKVSEFCANCLRGPAPGEKLLRCGGCN 69

  Fly    77 YVSYCHRSCQMQAWGQHKHECPFLKKVHPRVVPDAARMLCRLILR---LEHGGDLIRGYYTEHGS 138
            :..||.:.||..||..||.||..||...|.:.......|.::|.|   ||..||.: |...|   
 Worm    70 FSMYCSKECQATAWLVHKPECKRLKASFPNLPLTEVLFLSKVIDRIQFLEKNGDKL-GIEAE--- 130

  Fly   139 RKFRDLMSHYAEIKNDPMRLEHLDSLHAVLTDMMAESPSTVPNKTELMSIYGRLITNGFNILDAE 203
            |||..|:.|..:|::|..::.|.:.   :...|.|.....:..|.|...::.:...|..:|....
 Worm   131 RKFSSLVDHKVDIRDDEEKMAHFEK---IFEKMGAFRGEEMIEKGEFFDVFCKATINSHSIHTNA 192

  Fly   204 MNSIATAIYLGVSITDHSCQPNAVATFEGNELHVH-AIEDMECLDWSKIFISYIDLLNTPEQRRL 267
            .|.:..|:.||||..:|||:|.....|:|..:.:. .:..::..:..:.||||||:..:...||.
 Worm   193 GNEVGMALDLGVSKYNHSCRPTCSMVFDGYRVCLRPLVPGVDAENTEEAFISYIDVGRSKYIRRR 257

  Fly   268 DLKEHYYFLCVCSKCTDAKESKEMLAALCPNRNCGAGISVDRNNCPRCDAGISPKLRNAFNEAMT 332
            ||...:||.|.|::|.| .|...:.|..|.|              |.|||   |.|.:...|.|.
 Worm   258 DLNSRWYFNCECTRCMD-PEDDALTAIRCAN--------------PACDA---PILTSETEEPMN 304

  Fly   333 LTRHNLENMKDVAYLDVCKVCLDKQTGVFHPLNVWYVKTLDAAFE----AAIEV--GKWSDALDY 391
            :.   .|..|.:...|..|...:            |:|||.|:|:    |.||.  ||..:.|..
 Worm   305 IA---CEKCKTIVEEDTVKAAQE------------YMKTLPASFDPKCPAEIEALPGKLKELLAK 354

  Fly   392 GQRLLPGFRKYHGPWNPLLGLLHMKLGKI--------------QLYEGHS--------------- 427
            .:::|      | |.|..:..|...|..:              |:|..:.               
 Worm   355 AEQIL------H-PSNVYVARLRTALFHVTGTLTMDNLSSMHTQIYNNYKMCFPKADRHVGFQLL 412

  Fly   428 ------------KEALHHLEEAQRILTVTHGRDH 449
                        .||:.:..:|..|..|..|.||
 Worm   413 HIVKALIEKDERDEAMPYAFDAMNIFEVCFGLDH 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 17/41 (41%)
TPR_12 377..440 CDD:290160 17/110 (15%)
set-18NP_871849.1 zf-MYND 49..90 CDD:280009 17/41 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 1 1.000
Homologene 1 1.000 H41491
Inparanoid 1 1.050 130 1.000 Inparanoid score I3171
Isobase 1 0.950 0 Normalized mean entropy S4564
OMA 1 1.010
OrthoDB 1 1.010 D553549at33208
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 1 1.000 T375282
orthoMCL 1 0.900 OOG5_128877
Panther 1 1.100 O PTHR12197
Phylome 1 0.910 0.846 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2289
TreeFam 1 0.960
1413.820

Return to query results.
Submit another query.