DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd3 and SMYD4

Sequence 1:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_443160.2 Gene:SMYD4 HGNCID:21067 Length:804 Species:Homo sapiens

Alignment Length:504 Identity:108/505 (21%)
Similarity:177/505 (35%) Gaps:140/505 (28%)


  Fly    60 CDNCLEAT-KVLKCSNCRYVSYCHRSCQMQAWG-QHKHECPF----------------------- 99
            |..||:.| ..:.|..|.|..||.:.|..|||. .|:.|||.                       
Human   296 CHRCLKHTLATVPCDGCSYAKYCSQECLQQAWELYHRTECPLGGLLLTLGVFCHIALRLTLLVGF 360

  Fly   100 --LKKVHPRV----------VPDAARMLCRLILRL---EHGGDL---------IRGYYTEHGSRK 140
              ::|:..::          :|::...:..|...|   |..|::         |.|.|..:.:..
Human   361 EDVRKIITKLCDKISNKDICLPESNNQVKTLNYGLGESEKNGNIVETPIPGCDINGKYENNYNAV 425

  Fly   141 FRDLMSHYAEIKNDPMRLEH----------------LDSLHAVLTDMMAES--------PSTVPN 181
            | :|:.|..  .:.|   ||                ..||.|:.|:.:..|        |...|:
Human   426 F-NLLPHTE--NHSP---EHKFLCALCVSALCRQLEAASLQAIPTERIVNSSQLKAAVTPELCPD 484

  Fly   182 KT-----------------ELMSIYGRLITNGFNILDAEMNSIATAIYLGVSITDHSCQPN---- 225
            .|                 :.|:........|..:.|:....:||.|:..:|:.:|||.||    
Human   485 VTIWGVAMLRHMLQLQCNAQAMTTIQHTGPKGSIVTDSRQVRLATGIFPVISLLNHSCSPNTSVS 549

  Fly   226 ---AVATFEGNELHVHAIEDMECLDWSKIFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAKE 287
               .|||...::......|.:.|....|..:..       .:|:..|:..|:|.|.|..|  ..|
Human   550 FISTVATIRASQRIRKGQEILHCYGPHKSRMGV-------AERQQKLRSQYFFDCACPAC--QTE 605

  Fly   288 SKEMLA-----ALCPNRNCGAGISVDRNNCPRC------DAGIS--------PKLRNAFNEAMTL 333
            :..|.|     |.|.| :|||.:..|  :..||      ::.:|        ..|:.....|..|
Human   606 AHRMAAGPRWEAFCCN-SCGAPMQGD--DVLRCGSRSCAESAVSRDHLVSRLQDLQQQVRVAQKL 667

  Fly   334 TRHNLENMKDVAYLDVCKVCLDKQTGVFHPLNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPG 398
            .|.. |..:.|..|..|:...:......|.:   ..:..|....|...:|.|..:..:.||.|..
Human   668 LRDG-ELERAVQRLSGCQRDAESFLWAEHAV---VGEIADGLARACAALGDWQKSATHLQRSLYV 728

  Fly   399 FRKYHGPWNPLLGLLHMKLGKIQLYEGHS-KEALHHLEEAQRILTVTHG 446
            ....|||.:..:|....||.:| .:.|.: .|||..:::|:.:|::..|
Human   729 VEVRHGPSSVEMGHELFKLAQI-FFNGFAVPEALSTIQKAEEVLSLHCG 776

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 15/39 (38%)
TPR_12 377..440 CDD:290160 18/64 (28%)
SMYD4NP_443160.2 TPR repeat 68..96 CDD:276809
PLN03088 <72..>237 CDD:330826
TPR repeat 101..135 CDD:276809
S-adenosyl-L-methionine binding. {ECO:0000250} 112..114
TPR repeat 143..171 CDD:276809
zf-MYND 296..335 CDD:307734 15/39 (38%)
SET <528..574 CDD:307139 14/46 (30%)
S-adenosyl-L-methionine binding. {ECO:0000250} 539..540 0/1 (0%)
TPR_12 660..726 CDD:315987 14/70 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56190808
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.