DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smyd3 and smyd1

Sequence 1:NP_524768.2 Gene:Smyd3 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster
Sequence 2:XP_012811600.1 Gene:smyd1 XenbaseID:XB-GENE-978314 Length:491 Species:Xenopus tropicalis

Alignment Length:456 Identity:107/457 (23%)
Similarity:198/457 (43%) Gaps:64/457 (14%)


  Fly    38 GQRILTEKPFAFVLKSQYRLERCDNCLE-ATKVLKCSNCRYVSYCHRSCQMQAWGQHKHECPFLK 101
            |..|..|..::.|:........|.:|.: ..|:|:|..|::..||.|:||.::|..||:||..:|
 Frog    25 GDIIFAEPAYSAVVFDNLSHSVCHSCFKRQEKLLRCGQCKFAHYCDRTCQKESWANHKNECVAIK 89

  Fly   102 KVHPRVVPDAARMLCRLILRLEHGGDLIRGYYTEHGSRKFRDLMSHYAEIKNDPMRLEHLDSLH- 165
            |. .:...:..|:..|::.|:|..|..:    ||.......||.:|          ::..|... 
 Frog    90 KA-GKAPNENIRLAARILWRIEREGSGL----TEGCLVSIDDLQNH----------IDKFDEAEK 139

  Fly   166 AVLTDMMAESPSTVPNKTE------LMSIYGRLITNGFNILDAE-MNSIATAIYLGVSITDHSCQ 223
            .:|.:.:.:.....|::::      :..|:..:..|||.:.|.. :.::...|:..:.:.:|.|.
 Frog   140 GLLMEDVQKFLEYWPSQSQQFGMQYISHIFSVISCNGFTLSDQRGLQAVGVGIFPNLCLANHDCW 204

  Fly   224 PNAVATF-EGNE------LHVHAIEDMECL----DWSKIFISYIDLLNTPEQRRLDLKEHYYFLC 277
            ||....| .||.      .|.....::..|    ...::.:||:|.||..|.|:..||:.|||.|
 Frog   205 PNCTVIFNNGNHEAVRSMFHTQMRIELRALGKINKGEELTVSYVDFLNLTEDRKAQLKKQYYFDC 269

  Fly   278 VCSKCTDAKESKEMLAALCPNRNCGAGISVDRNNCPRCDAGISPKLRNAFNEAMTLTRHNLENMK 342
            .|..||  |::|:.|.           ::|.       |....|:.| ...|.:..::..:|.::
 Frog   270 TCEHCT--KKTKDALL-----------LAVK-------DGEDKPEER-VVKEVIQYSKDTMEKIE 313

  Fly   343 ----DVAYLDV---CKVCLDKQTGVFHPLNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPGFR 400
                :..|.||   |:.||.:|..:|...|::.::.|....|....:..:.||.:..::::.|:.
 Frog   314 KARSEGLYNDVVKLCRDCLKRQEPIFADTNIYMLRILSIYSEVLSYLQMFDDAAENAKKMVDGYL 378

  Fly   401 KYHGPWNPLLGLLHMKLGKIQLYEGHSKEALHHLEEAQRILTVTHGRDHRLLTEQLYMLVLQARQ 465
            |.:...|..||:..|:.|....:.|..:.....:.:|..||.:|||..|. :|:.|.::..|...
 Frog   379 KIYHQNNAQLGMAVMRAGVTHWHAGMIEVGHGMICKAFAILLITHGPLHP-ITKDLEVMRAQTEM 442

  Fly   466 E 466
            |
 Frog   443 E 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 15/38 (39%)
TPR_12 377..440 CDD:290160 12/63 (19%)
smyd1XP_012811600.1 zf-MYND 47..85 CDD:280009 15/38 (39%)
SET <189..252 CDD:214614 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56268115
eggNOG 1 0.900 E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D553549at33208
OrthoFinder 1 1.000 FOG0000247
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2289
TreeFam 1 0.960
76.740

Return to query results.
Submit another query.