DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hnf4 and nhr-183

Sequence 1:NP_723413.1 Gene:Hnf4 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_503621.1 Gene:nhr-183 WormBaseID:WBGene00018266 Length:394 Species:Caenorhabditis elegans

Alignment Length:400 Identity:79/400 (20%)
Similarity:141/400 (35%) Gaps:98/400 (25%)


  Fly   170 CAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRN------QCRYCRLR 228
            |.||...|.|:|:|..||..|..|:||:.....:   :...||:.:..|:.      .||.|||:
 Worm     4 CQICEQPAHGQHFGVVSCRACAAFYRRATLNPKK---KILPNCIHEDGKKMDENGVFSCRRCRLK 65

  Fly   229 KCFKAGMKKEAVQNERDRISCRRTSNDDPDP-------GNGLSVISLVKAENESRQSKAGAAMEP 286
            ||.|.||.....|.|||.||...:..:.|..       .|.|...:.::....::.....:.:..
 Worm    66 KCLKKGMDASKFQLERDLISSSLSMAEIPQTLSTFLGRPNFLLFCNPLEPSTTAKTVVDFSCLLE 130

  Fly   287 NINEDLSNKQFASINDVCESM---------------------------------KQQLLTLVEWA 318
            ..||.|.|.::...|....|:                                 :|::|...:|.
 Worm   131 RANELLKNGRWNPYNSEISSLEKMAMRYENMQIIKSSRLRHLSRMGKDETILIWEQKILNTTDWL 195

  Fly   319 KQIPAFNELQLDDQVALLR------------AHAGEHLLLGLSRRSMHLKDVLLLSNN--CVITR 369
            .....||.|.||.|:.:::            |...|     |.|:.:...|.:.:..:  |:.::
 Worm   196 TNFNEFNVLPLDVQLKIVKTIWQVYGRFEKIAKTAE-----LRRKKLIEHDNVFMVGDEACLNSK 255

  Fly   370 HCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLN-------EPH 427
            :.       .:|:|.......:::...| |...||.....:|.....:|....||       ..|
 Worm   256 NV-------EMDVSWYTDYSFEQIAYFM-DCFHDDIYLQIVKEFETLNPTPIELNFMLLQVCLHH 312

  Fly   428 RIKSLRHQILNNLEDYISD--------------RQYESRGRFGEILLILPVLQSITWQMIEQIQF 478
            ..|.|...:| .|.||:.:              :......|...::.:..::::...:..|::|.
 Worm   313 AGKKLHGDML-ELTDYLQEVISNQLHNHYLNVRKMPNYSARLARMMKVNNLMRTDLRRQSEKVQL 376

  Fly   479 AKIFGVAHID 488
            |..|.|..::
 Worm   377 AMAFDVFKLE 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 29/81 (36%)
NR_LBD_HNF4_like 264..494 CDD:132729 44/293 (15%)
nhr-183NP_503621.1 ZnF_C4 3..75 CDD:197701 26/74 (35%)
Hormone_recep 165..373 CDD:278530 34/222 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.680 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.