DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hnf4 and nhr-141

Sequence 1:NP_723413.1 Gene:Hnf4 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001023845.2 Gene:nhr-141 WormBaseID:WBGene00017787 Length:433 Species:Caenorhabditis elegans

Alignment Length:431 Identity:90/432 (21%)
Similarity:166/432 (38%) Gaps:106/432 (25%)


  Fly   139 SPNNNLSGSGSGTNSSQQQLQQQQQQQS-------PTVCAICGDRATGKHYGASSCDGCKGFFRR 196
            |.:|..||.....|..|:....:..::|       ||.|::||.:|||.||...||:|||.||||
 Worm     5 SCSNIASGESLDLNWPQRLSDCKMSKESTFQRHPRPTECSVCGKKATGYHYDVPSCNGCKTFFRR 69

  Fly   197 SVRKNHQYTCRFARNCVVDKDKR---NQCRYCRLRKCFKAGMKKEAVQ-NERDRIS--------- 248
            .........|:...:| .|..||   .:||.||..||...||...|:| :|::..:         
 Worm    70 ICISEKTMQCQGVGDC-FDLTKRIAPVKCRACRFEKCVLKGMNPNAMQIDEKEESAKNYKHLKKL 133

  Fly   249 ----CRRTSNDDPDPGNGLSVISLVKAENESRQSK---AGAAMEPNINE---DLSNKQFASI--- 300
                |::.|....:....::.|..:    |::..|   |.:.:|..:.:   ...|..:::|   
 Worm   134 KNQYCQKDSEHSMEKKQTINSIDAI----ETKMQKLVDALSYLEIKLRKFRLSAYNPHWSTIPCL 194

  Fly   301 -------NDVCESMKQ---------------------------------------QLLTLVEWAK 319
                   |.:|.:.|.                                       .|:..:|:||
 Worm   195 EEFLLLENKICLADKSGPMPGWPLKTQPAPPKIPEFRNNPSGRPYFPDKKTWLLYDLMVSIEYAK 259

  Fly   320 QIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHLKDVLLLSNNCVITRHCPDPLVSPNLDISR 384
            ....|::|...|::.|:|       .:.|:..::|:....:......|..  ||..::| ::...
 Worm   260 TFMFFHQLGTRDRLILMR-------YVSLALMNLHISYFTVAKKFDTIIH--PDGSLAP-MNKGM 314

  Fly   385 IGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSL---RHQILNNLEDYISD 446
            :.|..:..:..::: ..|.:.|:..:||:...:|....|: .|..|.|   |.|..:.|.|:...
 Worm   315 VYAETVMSMAPLIR-CNIQEIEYILLKAICLCNPAVPELS-THAQKILAKEREQYADALFDHCIR 377

  Fly   447 RQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHI 487
            .:.....:|.|::.::.:|:       .|.:..|...:.||
 Worm   378 SRTNGPAQFAELISMVDILE-------RQQRMQKDLHLLHI 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 33/79 (42%)
NR_LBD_HNF4_like 264..494 CDD:132729 46/283 (16%)
nhr-141NP_001023845.2 NR_DBD_HNF4A 43..119 CDD:143518 32/77 (42%)
HOLI 249..399 CDD:214658 32/169 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24083
Phylome 1 0.910 0.813 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.