| Sequence 1: | NP_723413.1 | Gene: | Hnf4 / 44544 | FlyBaseID: | FBgn0004914 | Length: | 732 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001023845.2 | Gene: | nhr-141 / 184926 | WormBaseID: | WBGene00017787 | Length: | 433 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 431 | Identity: | 90/431 - (20%) | 
|---|---|---|---|
| Similarity: | 166/431 - (38%) | Gaps: | 106/431 - (24%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   139 SPNNNLSGSGSGTNSSQQQLQQQQQQQS-------PTVCAICGDRATGKHYGASSCDGCKGFFRR 196 
  Fly   197 SVRKNHQYTCRFARNCVVDKDKR---NQCRYCRLRKCFKAGMKKEAVQ-NERDRIS--------- 248 
  Fly   249 ----CRRTSNDDPDPGNGLSVISLVKAENESRQSK---AGAAMEPNINE---DLSNKQFASI--- 300 
  Fly   301 -------NDVCESMKQ---------------------------------------QLLTLVEWAK 319 
  Fly   320 QIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHLKDVLLLSNNCVITRHCPDPLVSPNLDISR 384 
  Fly   385 IGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSL---RHQILNNLEDYISD 446 
  Fly   447 RQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHI 487 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Hnf4 | NP_723413.1 | NR_DBD_HNF4A | 170..245 | CDD:143518 | 33/78 (42%) | 
| NR_LBD_HNF4_like | 264..494 | CDD:132729 | 46/282 (16%) | ||
| nhr-141 | NP_001023845.2 | NR_DBD_HNF4A | 43..119 | CDD:143518 | 32/76 (42%) | 
| HOLI | 249..399 | CDD:214658 | 32/168 (19%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24083 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.010 | |||||