DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hnf4 and nhr-258

Sequence 1:NP_723413.1 Gene:Hnf4 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_501348.4 Gene:nhr-258 WormBaseID:WBGene00016126 Length:398 Species:Caenorhabditis elegans

Alignment Length:398 Identity:91/399 (23%)
Similarity:146/399 (37%) Gaps:108/399 (27%)


  Fly   168 TVCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFK 232
            ::|.:|.|.....|||...|..|||||||....:.::.|.....||:.|..||.||.||.:||.:
 Worm    12 SICRVCDDSNGQPHYGTICCPSCKGFFRRVYMSDKKFECYRGNMCVIQKGTRNICRACRYKKCLQ 76

  Fly   233 AGM----------KKEAVQNERDRISCRRTSNDDPDPGNGLS--------VISLVK-AENESRQS 278
            .||          ..::|:.||.. |...|.....|...|::        .::|.| .||...:|
 Worm    77 VGMNVKDIRGKYTSPQSVEYERSS-SAESTPKSSKDTEMGVAEAMEMAQVYMNLEKYCENNYCES 140

  Fly   279 KAGAAME-----------------------PNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQ 320
            ......|                       |....|....:..::.:.|.|..:.::..:::|.:
 Worm   141 NMCREEENRLIDRMLSSTVHELIQKTSPQCPRFKRDWKPLEMLNLENFCRSWSRSIVHFLDFATR 205

  Fly   321 IPAFNELQLDDQVALL----------------RAHAGEHLLLGLSRRSMHLKDVLLLSNN---CV 366
            .|.||:|...|:.|..                |....|.||.|.|       :|..|.::   .|
 Worm   206 FPVFNQLSHIDKRAWFISRLAPCSFLTMAYQTRIEMCEGLLFGCS-------NVFPLKSDRWIAV 263

  Fly   367 ITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDP-------NAKGL- 423
            .|.|....       .|.|...:...::..|.::.|.|..::.:||.|||..       :.||: 
 Worm   264 ETEHLRGL-------FSSITETMFSFVIYPMMNLKITDLHYSLLKACVFFSAGIVVTSVSDKGME 321

  Fly   424 ---NEPHRIK-SLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGV 484
               ||..:.| :|...::|.:|            ||.:...||..:|.:. ..:|::.       
 Worm   322 IMRNEYTKHKNALMKLLMNGVE------------RFSQQTDILFQIQDVQ-NTLERVS------- 366

  Fly   485 AHIDSLLQ 492
            ||.|..:|
 Worm   367 AHFDQEIQ 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 31/85 (36%)
NR_LBD_HNF4_like 264..494 CDD:132729 56/293 (19%)
nhr-258NP_501348.4 ZnF_C4 13..80 CDD:197701 28/67 (42%)
HOLI 192..356 CDD:214658 40/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.702 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.