DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hnf4 and nhr-65

Sequence 1:NP_723413.1 Gene:Hnf4 FlyBaseID:FBgn0004914 Length:732 Species:Drosophila melanogaster
Sequence 2:NP_001024219.1 Gene:nhr-65 WormBaseID:WBGene00003655 Length:401 Species:Caenorhabditis elegans

Alignment Length:392 Identity:85/393 (22%)
Similarity:147/393 (37%) Gaps:81/393 (21%)


  Fly   166 SPTVCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKC 230
            ||..|.:|||...|.|:||.:|..|..||||:..:      :|.|.|........:|:.|||::|
 Worm     9 SPERCKVCGDTGNGMHFGAFTCRACAAFFRRAASR------KFLRKCENHLIFALKCKNCRLQRC 67

  Fly   231 FKAGMKKEAVQNERDRISCRR--------------------TSNDDPD----PGNGLSVISLV-K 270
            ::|||..|..|..||.|..:.                    ....||:    ..|.:..:.|: |
 Worm    68 YEAGMSSENFQFCRDLIGAKGAIPKLKVPKSFEQTVGRPYFVLQCDPEVLFLRRNIIDCVPLLEK 132

  Fly   271 AENESRQSKAGAAMEPN----INEDLSNKQFASINDV--CESMKQQ---------LLTLVEWAKQ 320
            ||..............|    :.:.|...|.|..|.|  .:.|.|:         .|...:|...
 Worm   133 AEKLIEFGSESPVFSKNRLLKLAQGLQQFQDAKSNQVKFVQKMGQKEIMSFFETDFLCATKWFTY 197

  Fly   321 IPAFNELQLDDQVALLRA--HAGEHL-LLGLS----RRSMHLKDVLLLSNN-----CVITRHCPD 373
            :..|..|..:.|:.|::.  |....| .|.:|    ||.:..|:.:::|:.     |.:.....|
 Worm   198 LDEFQFLDKNQQLTLMQGIWHVWSRLHKLAVSAMGRRRGICDKNTVMVSHQNEFAVCDLNEIEVD 262

  Fly   374 PLVSPN---------LDISRIG--ARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPH 427
            .....|         ||.|...  .:::||::. :|...::.:...|...|.:.....:|     
 Worm   263 MSWCTNFSNEQMRYFLDTSHDSYVYQVMDEMLG-LKPNDVELSYMMCQLCLQYAGQRFQG----- 321

  Fly   428 RIKSLRHQILNNLED-----YISD-RQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAH 486
            .|.....::|..|.|     |:.. |......|..:::.|...::....:|.::.:.:::|.:..
 Worm   322 EILEFCEKMLGFLADDLHSYYVKQLRMPNYAARLAKLMKINNRIKVDMLKMRQRQEISRVFDIWT 386

  Fly   487 ID 488
            ||
 Worm   387 ID 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hnf4NP_723413.1 NR_DBD_HNF4A 170..245 CDD:143518 28/75 (37%)
NR_LBD_HNF4_like 264..494 CDD:132729 50/271 (18%)
nhr-65NP_001024219.1 NR_DBD_like 13..75 CDD:295381 25/68 (37%)
Hormone_recep 165..375 CDD:278530 39/216 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.692 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.