DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Grb7

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_445855.1 Gene:Grb7 RGDID:619759 Length:535 Species:Rattus norvegicus

Alignment Length:117 Identity:31/118 (26%)
Similarity:49/118 (42%) Gaps:22/118 (19%)


  Fly  1130 SVNESIPSSATAPKSPPESKPAPPSISGYVALKSTKVEVKLQEPETKPVSLQVKLKPTVQPATTP 1194
            |..:..|:..|.|::||.....||.            :||..:|...|.|.::: :...|..:.|
  Rat    13 SPEDVCPTPGTPPETPPPPDNPPPG------------DVKRSQPLPIPSSRKLR-EEEFQATSLP 64

  Fly  1195 SPPPP------PPALQPVKTNGGRSGPTAPDPR-SQLLDAIRNFKREDLNRS 1239
            |.|.|      ||:.:|:.  ||.||.....|| |..|..::.:..:...||
  Rat    65 SIPNPFPELCSPPSQKPIL--GGSSGARGLLPRDSSRLCVVKVYSEDGACRS 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064
Grb7NP_445855.1 GRB7_RA 102..183 CDD:176382 2/14 (14%)
PH_APBB1IP 224..350 CDD:269961
PH 229..341 CDD:278594
BPS 369..413 CDD:286088
SH2_Grb7 428..535 CDD:198276
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.