DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Raph1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_006496385.1 Gene:Raph1 MGIID:1924550 Length:1318 Species:Mus musculus

Alignment Length:1205 Identity:229/1206 (19%)
Similarity:332/1206 (28%) Gaps:516/1206 (43%)


  Fly    86 LPKDQLFVARLGARVPLSKLLSLVCDNKQLD------ADKY--EFRSPVDA------SQVYSCES 136
            :||.:..|:|           .||| ..|||      ...|  ::::|.|.      .|:.....
Mouse   481 VPKGKAKVSR-----------DLVC-FLQLDHVNVYYGQDYRNKYKAPTDCCLALKHPQIQKKSQ 533

  Fly   137 TIGTVGLSEIRLCHK-----------SESYDNFNPDVMHKFQRTGVARD--SLSSSSDFSSSRHS 188
            .|..:...:.|..|:           .:.|.|:    ....:||..|.|  ||||||..|.|..|
Mouse   534 YIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNY----QEALKRTESAYDWTSLSSSSIKSGSSSS 594

  Fly   189 KVTAKTPSPYSSSNSLNSMDS-------TG--------------------------------MNY 214
            .:      |.|.||..|..||       ||                                ||.
Mouse   595 SI------PESQSNHSNQSDSGVSDTLPTGHIRSQSTVSSIFSEAWKRGTQLEESSKARMESMNR 653

  Fly   215 TRT---PVVVPPAKVLA--------------PPPRKKRTAPRPPSQVCIPEQSVPDIPAANSKSE 262
            :.|   |.:.|..|::.              |||......|.||....:|.||.|...:| :...
Mouse   654 SYTSLMPPLSPQTKIITPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSSGSA-ATMF 717

  Fly   263 PAYAVIVKRPQLCM--------STPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPPIAGGP 319
            ..|:.|.:......        .||....||.|   .:.||:......:|     .:.||....|
Mouse   718 VKYSTITRLQNAAQHSGTLFKSPTPPAMQPLPL---ASQSKAQIVVPPNG-----VIPPPPPPPP 774

  Fly   320 EPTPRKRLLQIK--------KKTAPAPPPDFQSGGDNISL---ASLPEPVTPTPNIPQPAPRITT 373
            .|||...:.|:|        .:.:|.|||        :.:   ..||:...||   |.|||.||.
Mouse   775 PPTPGSAMAQLKPVPCAPSLPQFSPQPPP--------LKIHQVQHLPQTAPPT---PPPAPPITA 828

  Fly   374 PLPIAPTANP-PLAQVNGNGNGSPNGNVSKVLLNRT-PTPEPRSLGSATEDDDNDTASKQADSGI 436
            .:|  |.|.| ||..:..:.:   ...||.|:.... |||.|          ....|.||....:
Mouse   829 TVP--PQAPPKPLVTIPPSAS---TKTVSPVVAQAVPPTPAP----------PVPPAKKQPVFPV 878

  Fly   437 GEPAPSPSVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAELTALTAQDIEEE 501
            ....|:|.|.|.|.                             |.|:.                 
Mouse   879 SHIPPTPPVQPTPH-----------------------------PPPTL----------------- 897

  Fly   502 DNHVDQPASITNGNLATPSSETSLTSWNYLDPISPPPDFSDQQMQKRNAGSLSPGSPLDEIVDEL 566
                  |...:.|                   :.|||               ||.||:..:|.::
Mouse   898 ------PKQQSFG-------------------VKPPP---------------SPLSPVPSVVKQI 922

  Fly   567 ATIINQQRLDTLIKKQPDPQMVEIESAKPNRLANFSITTAKSTTRIGRADSFQAGASGGGTEVAS 631
            |         :.....|.|..|:.:..|                                     
Mouse   923 A---------SQFPPPPTPPPVDSQPLK------------------------------------- 941

  Fly   632 SGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGESPSLQSPEVIKTILNSRKNSLAESGGS 696
                                              |:..|.:.|||..:|.               
Mouse   942 ----------------------------------SLPASGTPQSPPAVKA--------------- 957

  Fly   697 ASTPVTEQPKIIKQLESLAKEQSSVDGVKDISSSRSEASQQSPTPVPKKSNPGVEKPTSPTFRAV 761
                   :||                            .|.|..|||....|.....:|..|   
Mouse   958 -------KPK----------------------------WQPSSIPVPSPDFPPPPPESSLVF--- 984

  Fly   762 QEPYPSSPALQKSSPAVQEQRTSPVERPSLPPAVKSVEEQAVSLHQKEIVVQKESPPLESMKESF 826
              |.|..||   .:||.......|...|.:||......::..|..:|                  
Mouse   985 --PPPPPPA---PAPAPPPPPPPPPPPPPVPPTASPTPDKGGSPGKK------------------ 1026

  Fly   827 VIVSKMSPPAVKKVPDPFPKVEAVKEESSGN---------ESSQSTITPPNTPATPVSPVNLRNP 882
              .||||.|..||.|....:..::|..|...         :|..|...||....:|         
Mouse  1027 --TSKMSSPGGKKPPPTPQRNSSIKSGSCAEHPEPKRPSVDSLVSKFAPPAESGSP--------- 1080

  Fly   883 NNTMAEIEQSQRDEPAPSSKPLPTTYRYSGP--PSINFATWSERPKSTVAIKNEGDYIFGGAGKS 945
                     |:...|.|::.|.|.....||.  |.|:       .:..|:.|..   :..|.||.
Mouse  1081 ---------SKETPPPPAAPPKPGKLHLSGVNLPGIH-------QQGIVSAKAS---VLSGRGKD 1126

  Fly   946 --QQLTSPPSKLTIGVASPILRMGIPQGKEYHVPITVKPL-------KDEILENQQQ------EK 995
              .:..||||........|.:.:.:|       ||.:..:       |..::..|.|      .|
Mouse  1127 VVVEFPSPPSDSDFPPPPPEIELPLP-------PIEIPAVFSGNTSPKVAVVNPQPQLWSKTSVK 1184

  Fly   996 KEKPEVQ-------ELKDQEIEKESVSVKVKPKTPVKPVQKRIEKPLDQDQNSLQNHSSTLPRPA 1053
            |..|..:       .|...:|.::.....|.|:.|..|     :..|......|.:.:.||.|.:
Mouse  1185 KAPPPTRPKRNDSTRLTQADISEQPAMTTVVPQVPTSP-----KSSLSVQPGFLADLNRTLQRKS 1244

  Fly  1054 KSNRFTLPAAQNNQMVSHLTMNSLPRPVSSLERNRPVEANPAPAPFGQSTLRRTGFKERMLAKEQ 1118
            .:...:|.:::.::.....||:.:              |.|.|.|...|..::.||.        
Mouse  1245 ITRHGSLSSSRMSRAEPTATMDDM--------------ALPPPPPELLSDQQKAGFG-------- 1287

  Fly  1119 QEQEQALRIRVSVNESIPSSATAPKSPPESKPAPP 1153
                         ...|...||..:.||   ||||
Mouse  1288 -------------GSHISGYATLRRGPP---PAPP 1306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 100/601 (17%)
Raph1XP_006496385.1 UBQ 322..403 CDD:294102
PH_APBB1IP 445..567 CDD:269961 19/102 (19%)
PH 450..558 CDD:278594 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.