DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and RAPH1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_005246834.1 Gene:RAPH1 HGNCID:14436 Length:1302 Species:Homo sapiens

Alignment Length:1206 Identity:225/1207 (19%)
Similarity:326/1207 (27%) Gaps:533/1207 (44%)


  Fly    86 LPKDQLFVARLGARVPLSKLLSLVCDNKQLD------ADKY--EFRSPVDASQV----------- 131
            :||.:..|:|           .||| ..|||      ...|  ::::|.|...|           
Human   480 VPKGKAKVSR-----------DLVC-FLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQ 532

  Fly   132 ---YSCESTIGTV--GLSEIRLC-HKSESYDNFNPDVMHKFQRTGVARD--SLSSSSDFSSSRHS 188
               |.|...:.|:  .::.||:. :..:.|.|:    ....:||..|.|  ||||||..|.|..|
Human   533 YIKYLCCDDVRTLHQWVNGIRIAKYGKQLYMNY----QEALKRTESAYDWTSLSSSSIKSGSSSS 593

  Fly   189 KVTAKTPSPYSSSNSLNSMDS---------------------------------------TGMN- 213
            .:      |.|.||..|..||                                       ..|| 
Human   594 SI------PESQSNHSNQSDSGVSDTQPAGHVRSQSIVSSVFSEAWKRGTQLEESSKARMESMNR 652

  Fly   214 -YTR-TPVVVPPAKVLA--------------PPPRKKRTAPRPPSQVCIPEQSVPDIPAA----- 257
             ||. .|.:.|..|::.              |||......|.||....:|.||.|...:|     
Human   653 PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPPPPPPLPSQSAPSAGSAAPMFV 717

  Fly   258 --------NSKSEPAYAVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPP 314
                    .:.|:.:.|:........|.:.::...:.:..||                  .:.||
Human   718 KYSTITRLQNASQHSGALFKPPTPPVMQSQSVKPQILVPPNG------------------VVPPP 764

  Fly   315 IAGGPEPTPRKRLLQIKKKTAPAPP--PDFQSGGDNISLASLPEPVTPTPNIPQPAPRITTPLPI 377
            ....|.|||...:.|:  |.||..|  |.|.:....:.:..:.......|..|.|.|.|..||| 
Human   765 PPPPPPPTPGSAMAQL--KPAPCAPSLPQFSAPPPPLKIHQVQHITQVAPPTPPPPPPIPAPLP- 826

  Fly   378 APTANP-PLAQVNGNGNGSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGIGEPAP 441
             |.|.| ||..:                    |.|               |::|.....:.:.||
Human   827 -PQAPPKPLVTI--------------------PAP---------------TSTKTVAPVVTQAAP 855

  Fly   442 SPSVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAELTALTAQDIEEEDNHVD 506
            .....|.|.|:|                           :|:.                      
Human   856 PTPTPPVPPAKK---------------------------QPAF---------------------- 871

  Fly   507 QPASITNGNLATPSSETSLTSWNYLDPISPPPDFSDQQMQKRNAGSLSPGSPLDEIVDELATIIN 571
             |||....:..||             |:..||....:|.........||.||:..:|.::|    
Human   872 -PASYIPPSPPTP-------------PVPVPPPTLPKQQSFCAKPPPSPLSPVPSVVKQIA---- 918

  Fly   572 QQRLDTLIKKQPDPQMVEIESAKPNRLANFSITTAKSTTRIGRADSFQAGASGGGTEVASSGRAL 636
                 :.....|.|..:|.:..||                                         
Human   919 -----SQFPPPPTPPAMESQPLKP----------------------------------------- 937

  Fly   637 SHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGESPSLQSPEVIKTILNSRKNSLAESGGSASTPV 701
                                          :..:.:.|||..:|.                    
Human   938 ------------------------------VPANVAPQSPPAVKA-------------------- 952

  Fly   702 TEQPKIIKQLESLAKEQSSVDGVKDISSSRSEASQQSPTPVPKKSNPGVEKPTSPTFRAVQEPYP 766
              :||                            .|.|..|||....|    |..|....|..|.|
Human   953 --KPK----------------------------WQPSSIPVPSPDFP----PPPPESSLVFPPPP 983

  Fly   767 SSPALQKSSPAVQEQRTSPVERPSLPPAVKSVEEQAVSLHQKEIVVQKESPPLESMKESFVIVSK 831
            .||.              |...|..||......:::.|..:|                    .||
Human   984 PSPV--------------PAPPPPPPPTASPTPDKSGSPGKK--------------------TSK 1014

  Fly   832 MSPPAVKKVPDPFPKVEAVKEESSGNE----------SSQSTITPPNTPATPVSPVNLRNPNNTM 886
            .|.|..|| |.|.|:..:..:.|||.|          |..|..|||....:|             
Human  1015 TSSPGGKK-PPPTPQRNSSIKSSSGAEHPEPKRPSVDSLVSKFTPPAESGSP------------- 1065

  Fly   887 AEIEQSQRDEPAPSSKPLPTTYRYSGPPSINFATWSERPKSTVAIKNEGDYIFGGAGKSQ--QLT 949
                 |:...|.|::.|.|.....||   :|..  ....:..|:.|..   :..|.||..  :..
Human  1066 -----SKETLPPPAAPPKPGKLNLSG---VNLP--GVLQQGCVSAKAP---VLSGRGKDSVVEFP 1117

  Fly   950 SPPSKLTIGVASPILRMGIPQGKEYHVPITVKPL-------KDEILENQQQE------KKEKPEV 1001
            ||||........|...:.:|       ||.:..:       |..::..|.|:      ||..|..
Human  1118 SPPSDSDFPPPPPETELPLP-------PIEIPAVFSGNTSPKVAVVNPQPQQWSKMSVKKAPPPT 1175

  Fly  1002 Q-------ELKDQEIEKESVSVKVKPKTPVKP-----VQKRIEKPLDQ--DQNSLQNHSSTLPRP 1052
            :       .|...||.::.....|.|:.|..|     ||......|::  .:.|:..|.|...|.
Human  1176 RPKRNDSTRLTQAEISEQPTMATVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSRM 1240

  Fly  1053 AKSNRFTLPAAQNNQMVSHLTMNSLPRPVSSLERNRPVEANPAPAPFGQSTLRRTGFKERMLAKE 1117
            :::.    |.|         ||:.:              |.|.|.|...|..::.|:.       
Human  1241 SRAE----PTA---------TMDDM--------------ALPPPPPELLSDQQKAGYG------- 1271

  Fly  1118 QQEQEQALRIRVSVNESIPSSATAPKSPPESKPAPP 1153
                          ...|...||..:.||   ||||
Human  1272 --------------GSHISGYATLRRGPP---PAPP 1290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 100/599 (17%)
RAPH1XP_005246834.1 UBQ 321..402 CDD:294102
PH_APBB1IP 444..566 CDD:269961 21/102 (21%)
PH 449..557 CDD:278594 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.