DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2841 and grb7

DIOPT Version :9

Sequence 1:NP_001284821.1 Gene:CG2841 / 44529 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_003201390.1 Gene:grb7 / 563649 ZFINID:ZDB-GENE-091118-23 Length:530 Species:Danio rerio


Alignment Length:150 Identity:35/150 - (23%)
Similarity:53/150 - (35%) Gaps:48/150 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 DISSSRSEASQQSPTPVPKKSNPGVEKPTSPTFRAVQEPY-PSSPALQKSSPAVQEQRTSPVERP 789
            ::...|||......:||          .|.|...:|...| |||..||.|:|           |.
Zfish     2 EVKGCRSEVEVFRRSPV----------ETVPRRHSVSVKYSPSSQNLQMSTP-----------RS 45

  Fly   790 SLPPAVKSVEEQAVSLHQKEIVVQKESPPLESMKESFVIVSKMSPPAVKKVPDPFPKVEAVKEES 854
            |||..:::  ..:||...:   .:..|.||                    :|:|||:: ....:|
Zfish    46 SLPLNIRN--SHSVSSKGE---FRASSAPL--------------------IPNPFPEL-CSPTQS 84

  Fly   855 SGNESSQSTITPPNTPATPV 874
            .....|.....||:..:|.|
Zfish    85 PVLTGSLGVRDPPSDSSTHV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 34/149 (23%)
grb7XP_003201390.1 UBQ 103..185 CDD:294102 0/1 (0%)
PH_APBB1IP 225..347 CDD:269961
PH 230..334 CDD:278594
BPS 367..408 CDD:286088
SH2_Grb7_family 423..530 CDD:198197
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.