DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and grb10b

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_021322523.1 Gene:grb10b ZFINID:ZDB-GENE-091020-12 Length:595 Species:Danio rerio

Alignment Length:185 Identity:43/186 (23%)
Similarity:69/186 (37%) Gaps:60/186 (32%)


  Fly   634 RALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGESPSLQSPEV-IKTILNSRKNSLAE----- 692
            ||.:||          :.:.||...::|:|.    .|||.|..:| ::.::|...:||..     
Zfish    23 RAANHR----------QADLIGPSFQQSASH----NSPSHQEDDVDLEALVNDMNSSLESLYTSC 73

  Fly   693 SGGSASTPVTE--QP----------KIIKQLESLAKEQSSVDGVKDISSSRSEASQQSPTPVPKK 745
            |..|.|||:..  ||          :.|...:.|.:.|..  .:..:...:.||.|...:.:|  
Zfish    74 SVQSESTPLLHNGQPHRPSAYHTHAQPISPHQRLRRSQPM--NILAVRRLQEEAQQYRTSSLP-- 134

  Fly   746 SNPGVEKPTSPTFRAVQEPYPS--SPALQKSSPAVQEQRTSPVERPSLPPAVKSV 798
                          |:..|:|.  |||   |||.:     |....|...|:.|.:
Zfish   135 --------------AIPNPFPELCSPA---SSPTL-----SSGSLPQCQPSDKYI 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 43/186 (23%)
grb10bXP_021322523.1 GRB7_RA 165..246 CDD:176382 1/4 (25%)
PH_APBB1IP 286..408 CDD:269961
BPS 426..470 CDD:312490
SH2_Grb10 488..595 CDD:198278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.