DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and raph1b

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001352514.1 Gene:raph1b ZFINID:ZDB-GENE-090311-54 Length:1565 Species:Danio rerio

Alignment Length:1341 Identity:271/1342 (20%)
Similarity:416/1342 (31%) Gaps:475/1342 (35%)


  Fly    88 KDQLFVARLGA--RVPLSKLLS---LVCDNKQLD------ADKY--EFRSPVD------------ 127
            |.:.|:.|...  .||..|..:   ||| ..|||      ...|  ::::|.|            
Zfish   485 KKRYFLLRASGIYFVPKGKAKASRDLVC-FLQLDHVNVYYGQDYRSKYKAPTDYCLALKHPQIQK 548

  Fly   128 ASQV--YSCESTIGTV--GLSEIRLC-HKSESYDNFNPDVMHKFQRTGVARD--SLSSSSDFSSS 185
            .||.  |.|...:.|:  .::.||:. :..:.|.|:    ....:||..|.|  ||||:| ..|.
Zfish   549 KSQYIKYLCCDDVRTLHQWVNGIRIAKYGKQLYVNY----QEAMKRTEAAYDWSSLSSTS-IKSG 608

  Fly   186 RHSKVTAKTPSPYSSSNSLNSMDSTGMNYTRTPVVVPPAKVLAPPPRK-----KRTAPRPPSQVC 245
            ..|....::.|.:||.......|.|..::.|:..||  :.:.:...::     :.|..||     
Zfish   609 TSSVSIPESQSNHSSQTDSGMSDGTSSSHARSQSVV--SSIFSEAWKRGTQIEESTKARP----- 666

  Fly   246 IPEQSVPDIPAANSKSEPAYAVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLD 310
               :|:....:::|.....:  :.::..|....|::...|:  ..|:.:::|.:..|.    ||.
Zfish   667 ---ESIRSTHSSHSSHSSHH--VSQQQHLHAQQPHVHSILQ--SRGSVTQAPAQAPTQ----TLA 720

  Fly   311 LKPP-IAGGPEPTPRKRLLQIKKKTAPAPPPDFQSGGDNISLASLPEPVTPT-----------PN 363
            ..|| :|..|.|.|         ...|.|||.        .::|:|...|||           .|
Zfish   721 QAPPQVAPAPPPPP---------PPPPPPPPP--------PISSIPHHATPTMFAKYSTITRLQN 768

  Fly   364 IPQ------PAPRITTPLPIAPTANPPLAQVNGNGNGSPNG-NVSKVLLNRTPTPEPRSL---GS 418
            ..|      |.|:|...:|..|..:.|      ..|..|:| |:..    ..|.|.|.|:   ||
Zfish   769 ASQATSHHKPQPQIQQQVPPVPPPSKP------QSNNIPSGANIPP----PPPPPPPASMPPPGS 823

  Fly   419 ATEDDDNDTASKQADSGIGEPAPS--PSVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPE 481
            |           .|...:|.||.:  |.:||.|.:........            .:.....:|:
Zfish   824 A-----------MAVLKLGPPAAAVIPQISPSPPSPPPPPPPP------------PIMPVQSQPQ 865

  Fly   482 PSAATLAELTALTAQDIEEEDNHVDQPASITNGNLATPSSETSLTSWNYLDP-------ISPPPD 539
            |....:..:.:              ||       |..|...|.:.|.|...|       :.|||.
Zfish   866 PPPPPIMPMQS--------------QP-------LPPPPPITPMQSHNLPPPPPMQSHALPPPPP 909

  Fly   540 FSDQQMQKRNAGSLSPGSPLDEIVDELATIINQQRLDTLIKKQPDPQMVEIES-AKPNRLANFSI 603
            .:..|     :.:|.|..|:        |.:....|      .|.|.:..::| |.|        
Zfish   910 ITPMQ-----SHALPPPPPI--------TPMQSHAL------PPPPPITPMQSHALP-------- 947

  Fly   604 TTAKSTTRIGRADSFQAGASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIG 668
                                                                     ....::..
Zfish   948 ---------------------------------------------------------PPPPITPM 955

  Fly   669 ESPSLQSPEVIKTILNSRKNSLAESGGSASTPVTEQPKIIK-QLESLAKEQSSVDGVKDISSSRS 732
            :|.:|..|..|..:.:......|:.....|.|:...|.::: |.:.:.....:|          |
Zfish   956 QSHALPPPPPIMPMQSEPLPPPAQIMPMQSHPLPPPPPLVQMQSQPMPPPPPTV----------S 1010

  Fly   733 EASQQSPTPVPKKSNPGVEKP----TSPTFRAVQEPYPSSPALQKSSPAVQEQRTSPVERPSLPP 793
            ..||..|.|.|.....|:..|    |:...:|....:||:|  |...|...:....|...|..||
Zfish  1011 FQSQPLPPPPPPLQANGLPPPPPLITNGLKQAFAHKFPSTP--QDVLPPANQNNFPPPPPPPPPP 1073

  Fly   794 AVKSVEEQAVSLHQKEIVVQKESPPLESMKESFVIVSKMSPPAVKKVPDP--------------- 843
            .:      |.:|...:.|....:||              .||.....|.|               
Zfish  1074 PL------APTLPPYQHVTSTSNPP--------------PPPPPPPPPPPAPIHLANQPAVLPKF 1118

  Fly   844 ----FPKVEAVKEES-----SGNESSQSTITPPNTPATPVSPVNLRNPNNTMAEIEQSQRDEPAP 899
                ||..:|.|...     |....:.....||..|..|..|..|:|              :|.|
Zfish  1119 FTGGFPPQKAPKPSCGILPVSPVAPALQPPPPPPPPPPPPPPAPLKN--------------QPPP 1169

  Fly   900 S-------SKPLPTTYRYSGPPSINFATWSERPKSTVAIKNEGDYIFG----------------G 941
            :       ||.||.:.:.|..||:.....|:.|.::.|:.|:.|.:..                |
Zfish  1170 TLPKQHSLSKTLPFSSQTSSVPSMVKQLASQFPVASPALTNQTDSLKAPQSPPAVKVKPKWQPVG 1234

  Fly   942 AGKSQQ----LTSPPSKLTIGVASPI----LRMGIPQGKEYHVP------ITVKPLKDEILENQQ 992
            .|:.||    ...||....:|.|||.    ....:|.|.....|      ::..|:|.....:..
Zfish  1235 QGQQQQRSPEFPPPPPDNALGFASPTPPPPPPPPLPPGPTPPPPPPPPPLMSGSPIKKSPSGSSA 1299

  Fly   993 QEKKEKPEVQELKDQEIEKESVSVKVKPKTPVKPVQKRIEKPLDQDQNSLQNHSSTL-------- 1049
            ..||..|..|         .:.|||....|..:..:|.:....:....|....:|:.        
Zfish  1300 GVKKPPPTPQ---------RNSSVKYDASTEYQESRKNLVSKFNPSSASSTTSTSSCSPSKELSA 1355

  Fly  1050 -----PRPAKSNRFTLPAA------QNNQMVSHLTMNSLPRPVSSLERNRPVEA----------- 1092
                 |:|.|.|...||.|      ||.|  |.....|.|.|.:......|:|:           
Zfish  1356 GPQAPPKPGKLNLANLPLALQNKFNQNRQ--SAADFPSPPPPENDFFPPPPIESDLPPPPPLPGD 1418

  Fly  1093 -----------NPAPAP-FGQSTLRRTGFKERMLAKEQQEQEQALRIRVSVNESIPSSATAPKSP 1145
                       ||.|.| :|:|:|::|            :...:||...:|.||.|.|       
Zfish  1419 LNGVSPKVAVVNPQPQPAWGKSSLKKT------------QPPASLRCNNTVRESPPLS------- 1464

  Fly  1146 PESKPAPPSISGYVALKSTKVEVKLQEPETKPVSLQ-----VKLKPT------VQPATTPS---- 1195
                  ||||.|.....|.|       ..|:|..|:     :|.|.:      |.|..|..    
Zfish  1465 ------PPSIHGGPIPHSPK-------GTTQPNFLEDLNKTLKRKSSRVSGDKVDPVATMDDMVL 1516

  Fly  1196 PPPPPPALQPVKTNGG---------------RSGPTAPDPR 1221
            |||||..||..:...|               |..|.||..|
Zfish  1517 PPPPPELLQDQQRLSGSGFMSGNISGYATLRRGPPPAPPKR 1557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 116/656 (18%)
raph1bNP_001352514.1 UBQ 340..421 CDD:320785
PH_APBB1IP 463..585 CDD:269961 24/105 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.