DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and raph1a

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001353656.1 Gene:raph1a ZFINID:ZDB-GENE-070912-156 Length:1346 Species:Danio rerio

Alignment Length:1220 Identity:244/1221 (20%)
Similarity:355/1221 (29%) Gaps:511/1221 (42%)


  Fly    88 KDQLFVARLGA--RVPLSKLLS---LVC------DNKQLDAD-KYEFRSPVDASQV--------- 131
            |.:.|:.|...  .||..|..:   |||      .|..|..| :.::::|.|...|         
Zfish   472 KKRYFLLRASGIYYVPKGKAKASRDLVCFLQLDHVNVYLGQDYRSKYKAPTDYCMVLKHPQIQKK 536

  Fly   132 -----YSCESTIGTVGLSEIRLCHK-----------SESYDNFNPDVMHKFQRTGVARD--SLSS 178
                 |.|        ..::|:.|:           .:.|.|:    ....:||..|.|  ||||
Zfish   537 SQYIKYLC--------CDDVRMLHQWVNGIRIAKYGKQLYVNY----QEAMRRTEAAHDWSSLSS 589

  Fly   179 SSDFSSSRHSKVTAKTPSPYSSSNSLNSMDS-----TGMNYTRTPVVV----------------- 221
            ||..|.|..|.:      |.|.||..:..||     |...:.|:..||                 
Zfish   590 SSIKSCSSSSSL------PESQSNHSSQSDSGVSETTSSGHVRSQSVVSSIFSEAWKRGNQADEP 648

  Fly   222 ------PPAK-------VLAPP---------------PRKKRTAPRPPSQVCIPEQSVPDIPAAN 258
                  |||:       :..||               |....:.|.||.    |....|.:|...
Zfish   649 KMRIDGPPAQPARASYPLQLPPLPQSLQSRSSYSGVSPASPSSPPSPPP----PPPPPPPLPNPT 709

  Fly   259 SKSEPAYAVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPPIAGGPEPTP 323
            ..|.|  .|..|...|....             |.|::|:      ||..   .|.:|...:|||
Zfish   710 HHSTP--VVFTKYSTLARLQ-------------NISQAPN------HYKQ---TPLLAAQQQPTP 750

  Fly   324 RKRLLQIKKKTAPAPPPDFQSG--GDNISLASLPEPVTPTPNIPQ-PAP----RITTPLPIAPTA 381
                        |.|||.....  .:...:||.|.|..|.|..|: |.|    .:....||:|..
Zfish   751 ------------PVPPPQCLKPLMNNTTEVASSPPPAPPPPPPPEMPVPGSAMAVLKHAPISPQY 803

  Fly   382 NPP------LAQVNGNGNGSPNGNVSKVLLNRTPTPE------PRS-------LGSATEDDDNDT 427
            .||      .:.::.||...|           .|.||      |.|       |.....:...|.
Zfish   804 TPPPPPEEDPSYLHSNGYLPP-----------PPPPEQLKYPPPLSTNGLQQFLAQKFPNMTYDF 857

  Fly   428 ASKQADSGIGEPAPSPSV--SPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAEL 490
            :..|.|.   ||.|.|.|  ||.|                         |.|..|.|........
Zfish   858 SPVQQDE---EPPPPPPVCFSPPP-------------------------QQSGPPAPPKTFTGGF 894

  Fly   491 TALTAQDIEEEDNHVDQPASITNGNLA-TPS---SETSLTSWNYLDPISPPPDFSDQQMQKRNAG 551
            ...||    .:..|...|.|....:|: |||   .:.||:|.:  .|..|||....|......|.
Zfish   895 PPQTA----PKPGHGISPISPVPPSLSPTPSLMKKQQSLSSGH--SPNQPPPTLPKQYSLSSKAP 953

  Fly   552 SLS-PGSPLDEIVDELATIINQ--QRLD--------TLIKKQP--------DPQMVEIESAKPNR 597
            |:| |.||...:|.:   |:||  ..||        .::|.:|        .||..|.....|..
Zfish   954 SVSAPISPTQSLVKQ---IVNQFPDTLDGSKGPISPPVVKNKPKWQPGGQAQPQSPEFPPPPPES 1015

  Fly   598 LANFSITTAKSTTRIGRADSFQAGASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSS 662
            ...|....|.|..    ..|..:|.||                                      
Zfish  1016 TLEFPPPPAPSPP----PASQPSGKSG-------------------------------------- 1038

  Fly   663 SELSIGESPSLQSPEVIKTILNSRKNSLAESGGSASTPVTEQPKIIKQLESLAKEQSSVDGVKDI 727
                   ||..:||       ::..||...|||....|..::...:|...|:..::|.  .|:|:
Zfish  1039 -------SPIKKSP-------STSSNSSTGSGGKKPPPTPQRNSSMKATSSVEYQESK--KVEDL 1087

  Fly   728 SSSRSEASQQSPTPVPKKSNPGVEKPTSPTFRAVQEPYPSSPALQKSSPAVQEQR--TSP--VER 788
            .|...:.||..|:..                        |:|:....||:.:..|  |.|  :..
Zfish  1088 VSMFGQTSQAPPSSF------------------------STPSSTTGSPSKESSRALTKPGKINL 1128

  Fly   789 PSLPPAVKSVEEQAVSLHQKEIVVQKESPPLESMKESFVIVSKMSPPAVKKVPDPFPKVEAVKEE 853
            .:||.|:     |....|.::......||||:.                 :.|.|.|..|     
Zfish  1129 ANLPLAL-----QGRQSHCRQSSADFPSPPLDC-----------------EFPPPPPDSE----- 1166

  Fly   854 SSGNESSQSTITPPNTP------ATPVSPVNLRNPNNTMAEIEQSQRDEPAPSSKPLPTTY-RYS 911
                     .:.||..|      |..|:.|   ||....:....|...:.:....|.||.: |.|
Zfish  1167 ---------LLPPPPLPSELHIGAPKVAVV---NPQPQHSSSSTSSWKQSSLKKMPPPTMHRRSS 1219

  Fly   912 GPPSINFATWSERPKSTVAIKNEGDYIFGGAGKSQQLTSPPSKLTIGVASPILRMGIPQGKEYHV 976
            |||                              .|...|||                        
Zfish  1220 GPP------------------------------EQLALSPP------------------------ 1230

  Fly   977 PITVKPLKDEILENQQQEKKEKPEVQELKDQEIEKESVSVKVKPKTPVKPVQKRIEKPLDQDQNS 1041
                                         .|::...|.:.::.|.:|        :..|....|.
Zfish  1231 -----------------------------PQQMPLSSFNSQIPPTSP--------KANLSMQPNF 1258

  Fly  1042 LQNHSSTLPRPAKSNRFTLPAAQNNQMVSHLTMNSLPRPVSSLERNRPVEANPAPAP---FGQST 1103
            |::.:.||.|.:.:...:|.:::         :::...||::::.    .|.|.|.|   .||. 
Zfish  1259 LEDLNRTLKRKSMTRHGSLTSSR---------ISAKLEPVATMDD----MALPPPPPELLLGQQ- 1309

  Fly  1104 LRRTGFKERMLAKEQQEQEQALRIRVSVNESIPSSATAPKSPPESKPAPP 1153
             ::.|:                     .:.:|...||..:.||   ||||
Zfish  1310 -KKGGY---------------------TSANISGYATLRRGPP---PAPP 1334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 131/641 (20%)
raph1aNP_001353656.1 UBQ 327..408 CDD:320785
PH_APBB1IP 450..572 CDD:269961 21/112 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.