DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Apbb1ip

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_062329.2 Gene:Apbb1ip MGIID:1861354 Length:670 Species:Mus musculus

Alignment Length:321 Identity:78/322 (24%)
Similarity:124/322 (39%) Gaps:85/322 (26%)


  Fly   119 KYEFRSPVDASQV--------------YSCESTIGTVG--LSEIRLCHKSES-YDNFNPDVMHKF 166
            |.::::|.|...|              |.|.....|:.  :..||:....:: |||        :
Mouse   374 KMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIAKYGKTLYDN--------Y 430

  Fly   167 QRTGVARDSLSSSSDFSSSRHSKV-TAKTPSPYSSSNSLNSMDSTGMNYT--RTPVVVPPAKVLA 228
            || .|||..|       :||.:.: |..||.| :..::::|...||.:..  :.|..:|.|   .
Mouse   431 QR-AVARAGL-------ASRWTNLGTVGTPMP-AQPSTVSSGLKTGTSQPNGQMPQAIPSA---G 483

  Fly   229 PPPRKKRT---------------APRPPSQVCIPEQSVPDIP-----AANSKSEPAYAVIVKRPQ 273
            ||.::.:|               :|....:...|:.|:|..|     ::::...||....||.|.
Mouse   484 PPLQEAQTQIETTKDEKQGLGNHSPGATRENHRPKSSLPPPPPPVRRSSDTCGSPALPSKVKGPG 548

  Fly   274 LCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPPIAGGPEPTPRKRLLQIKKKTAPAP 338
            .| :.|:   |.|..........|:||::       .|.||    |.|.|   .|:......|.|
Mouse   549 TC-TFPH---PPENFLPPPPPPPPEEDNS-------GLLPP----PPPPP---YLEEPPDFVPPP 595

  Fly   339 PPDFQSGGDNISLASLPEPVTPTPNIPQPAPRITTPLPIAPTANPPLAQVNGNGNGSPNGN 399
            ||...     :..::||.|..|.|.:.|...: ::|||......||..|.|....|:| ||
Mouse   596 PPPAA-----VEDSALPPPPPPPPCLSQEITK-SSPLPPKKPLVPPKRQENQGLPGAP-GN 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 11/29 (38%)
Apbb1ipNP_062329.2 GRB7_RA 186..264 CDD:176382
PH_APBB1IP 310..431 CDD:269961 12/65 (18%)
PH 314..422 CDD:278594 9/48 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.