DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and APBB1IP

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_061916.3 Gene:APBB1IP HGNCID:17379 Length:666 Species:Homo sapiens

Alignment Length:352 Identity:79/353 (22%)
Similarity:116/353 (33%) Gaps:113/353 (32%)


  Fly   119 KYEFRSPVDASQV--------------YSCESTIGTVG--LSEIRLCHKSES-YDNFNPDVMHKF 166
            |.::::|.|...|              |.|.....|:.  :..||:....:: |||        :
Human   371 KMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDTRTLNQWVMGIRIAKYGKTLYDN--------Y 427

  Fly   167 QRTGVARDSLSSSSDFSSSRHSKVTAKTPSPYSSSNSLNSMDSTGMNYTRT---PVVVPPAKVLA 228
            || .||:..|:|    ..:....|.|..|:..|:.....:....|.....|   ..|:..|:..|
Human   428 QR-AVAKAGLAS----RWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHA 487

  Fly   229 PPPRKKRTA---------PRPPSQVCIPEQSVPDIPAANSKSEPAYAVIVKRPQLCMSTPNLSGP 284
            ...:.|:.|         ||.|.   .|:.|:|..|.....|:.:            .:|  :.|
Human   488 ETSKDKKPALGNHHDPAVPRAPH---APKSSLPPPPPVRRSSDTS------------GSP--ATP 535

  Fly   285 LEL-DCNGNGSKSPDEDSTDGHYATLDLKPPIAGGPEPTPRKRLLQIKKKTAPAPPPDFQSGGDN 348
            |:. ...|.|..:|.:|.         |.||    |.|.|      :.....|.|||||.....:
Human   536 LKAKGTGGGGLPAPPDDF---------LPPP----PPPPP------LDDPELPPPPPDFMEPPPD 581

  Fly   349 I------SLASLPEPVTPTPNIPQPAPRITTPLPIAPTANPPLAQVNGNGNGSPNGNVSKVLLNR 407
            .      |.|.:.....|.|..|.|||   .|.|:..:|.||.|             |:|    |
Human   582 FVPPPPPSYAGIAGSELPPPPPPPPAP---APAPVPDSARPPPA-------------VAK----R 626

  Fly   408 TPTP--------EPRSLGSATEDDDND 426
            .|.|        .|...|...:|..:|
Human   627 PPVPPKRQENPGHPGGAGGGEQDFMSD 653

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 15/64 (23%)
APBB1IPNP_061916.3 GRB7_RA 183..261 CDD:176382
PH_APBB1IP 307..428 CDD:269961 12/65 (18%)
PH 311..419 CDD:278594 9/48 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.