DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Grb14

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_057928.1 Gene:Grb14 MGIID:1355324 Length:538 Species:Mus musculus

Alignment Length:239 Identity:52/240 (22%)
Similarity:79/240 (33%) Gaps:93/240 (39%)


  Fly   125 PVDASQVYSCESTIGTVGLSEIRLCHKS-ESYDNFNPDVMHKFQRTGVARDSLSSSSDFSSSRHS 188
            |.|...:.:.|....|..::.|||.... :.|.|:    ||.:|    .|.:.:|.|        
Mouse   314 PRDLKMLCAEEEQSRTCWVTAIRLLKDGMQLYQNY----MHPYQ----GRSACNSQS-------- 362

  Fly   189 KVTAKTPSPYSSSNSLNSMDSTGMNYTRTPVVVPPAKVLAPPP------RKK-------RTAPRP 240
                .:|....|.|||.:||.:|   .::.|:..|.:.|:...      |||       ..:|..
Mouse   363 ----MSPMRSVSENSLVAMDFSG---EKSRVIDNPTEALSVAVEEGLAWRKKGCLRLGNHGSPSA 420

  Fly   241 PSQVCIPEQSVPDIPAANSKSEP----------AYAVIVKRPQLCMSTPNLSGPLE-----LDCN 290
            |||...       :..|..:|:|          |..:|:::           ||::     .|..
Mouse   421 PSQSSA-------VNMALHRSQPWFHHRISRDEAQRLIIRQ-----------GPVDGVFLVRDSQ 467

  Fly   291 GN----------GSK------SPDEDS-------TDGHYATLDL 311
            .|          |.|      .|.||.       .|||....||
Mouse   468 SNPRTFVLSMSHGQKIKHYQIIPVEDDGELFHTLDDGHTKFTDL 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064
Grb14NP_057928.1 GRB7_RA 104..188 CDD:176382
PH_APBB1IP 228..349 CDD:269961 9/39 (23%)
PH 233..339 CDD:278594 7/25 (28%)
BPS 368..412 CDD:286088 13/47 (28%)
SH2_Grb14 431..538 CDD:198277 18/93 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.