DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Grb10

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_008768569.1 Gene:Grb10 RGDID:1566234 Length:636 Species:Rattus norvegicus

Alignment Length:158 Identity:37/159 (23%)
Similarity:53/159 (33%) Gaps:69/159 (43%)


  Fly  1054 KSNRFTLPAAQNNQMVSHLTMNSLPR------PVSSLERNRPVEANPAPAPFGQSTLRRTGFKER 1112
            :|:..|:|..:|.|..|:....|..|      |...::|::||...|         |||.     
  Rat    56 QSDTDTVPLLENGQSASNQPSASSSRGQPQASPRQKMQRSQPVHIQP---------LRRL----- 106

  Fly  1113 MLAKEQQEQEQALRIRVSVNESIPSSATAPKSPPE---SKPAPPSISGYVALKSTKVEVKLQEPE 1174
                  ||::|.||     ..|:|:   .|...||   ..|..|                     
  Rat   107 ------QEEDQQLR-----TSSLPA---IPNPFPELAGGAPGSP--------------------- 136

  Fly  1175 TKPVSLQVKLKPTVQPATTPSPPPPPPA 1202
                       |:|.|::.|.||..|||
  Rat   137 -----------PSVAPSSLPPPPSQPPA 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064
Grb10XP_008768569.1 GRB7_RA 209..290 CDD:176382
PH_APBB1IP 328..450 CDD:269961
PH 333..441 CDD:278594
BPS 468..509 CDD:286088
SH2_Grb10 529..636 CDD:198278
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.