DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and grb10a

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001004287.1 Gene:grb10a ZFINID:ZDB-GENE-040822-32 Length:602 Species:Danio rerio

Alignment Length:594 Identity:119/595 (20%)
Similarity:179/595 (30%) Gaps:203/595 (34%)


  Fly   159 NPDVMHKFQRTGVARDSLSSSSDFSSSRHSKVTAKTP----------------SPYSS------- 200
            :|:......||...|.|....|.|.||  ::.:...|                |.|.|       
Zfish    13 HPNYQDNVDRTSSHRPSNLIGSSFQSS--TRTSPNHPEDDVDLEALVNDMASLSSYESIYATCEI 75

  Fly   201 --SNS---LNSMDSTGMNYTRTPVVVPPAKVLAPPPR---KKRTAPRPPSQVCIPEQSVPDIPAA 257
              |:|   |:|.||:|::..|          :||.||   .|.|||..|:|             .
Zfish    76 QHSDSAPLLHSTDSSGLHGNR----------VAPLPRAPSHKVTAPHSPAQ-------------R 117

  Fly   258 NSKSEPAYAVIVKRPQ------LCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPPIA 316
            ..:|:|.:...|:|.|      ...|.|.:..|....|:.:||                  |.::
Zfish   118 LRRSQPMHIHAVRRLQEEELQVRPASLPAIPNPFPELCSPSGS------------------PVLS 164

  Fly   317 GGPEPTP-RKRLLQIKKKTAPAPPPDFQSG-----------------GDNI-------SLASLP- 355
            .|..|.| ...::::..:.......:..:|                 .||.       ||..|. 
Zfish   165 PGSLPQPSESHIIKVFSEDGVGKVVEVTAGMMARDVCQFLVYKSHCLDDNCWSLVEHHSLLGLER 229

  Fly   356 -----EPVTPTPNIPQPAPR------------ITTPLPIAPTANPPLAQVNGNGNGS-PNGNVSK 402
                 |.|........|..:            ...||...|.......|   ..||| |...:.:
Zfish   230 CLEDHELVVSVKACMPPESKFLFRKNYAKYEFFRNPLNFFPEQMVAWCQ---ESNGSIPQSQLLQ 291

  Fly   403 VLLNRTPTPEPRSLGSATEDDDNDTASKQ--------ADSGIGEPAPSPSVSPEPEAEKSQQESS 459
            ..||.:..||.:......|     |..|.        ..||:.......|..|......|..|.|
Zfish   292 NFLNSSSCPEIQGFLYMKE-----TGRKSWKKLYMFLRRSGLYYSTKGMSKEPRHLQLLSDLEES 351

  Fly   460 S--EDDEAIKVYN----FKLCQTSKKPEPSAATLAELTALTAQDIEEE----------------- 501
            :  ......|::|    ::.|   .||......|.||..|.|:|.:..                 
Zfish   352 NIFTVTTGRKMHNAPTDYQFC---IKPSKGRTELKELKMLCAEDEQSRTCWMTAFRLLKFGILLY 413

  Fly   502 DNHVDQPASITNGNLATP---SSETSLTSWNYLD----PISPPPDFSDQQMQ------KRN---- 549
            .|:.......|..|..||   .||.||.:.::..    .|..|.:.....|:      ||:    
Zfish   414 QNYKTPHQRKTISNFTTPVRSVSENSLVAMDFSGRTGRVIDNPVEAQSAAMEEGHTWRKRSQRMN 478

  Fly   550 -AGSLSP--GSPLDEIV-------------DELATIINQQ-RLDTLI---KKQPDPQMVEIESAK 594
             .||.||  .|||..::             :|...:|.|| ::|.|.   ..|.:|:...:....
Zfish   479 VLGSPSPLHPSPLSSVIHRTQLWFHGRIMREESHRMIMQQGQVDGLFLLRDSQSNPKAFVLTLCH 543

  Fly   595 PNRLANFSI 603
            ..::.:|.|
Zfish   544 HQKIKHFQI 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 64/302 (21%)
grb10aNP_001004287.1 UBQ 175..255 CDD:294102 9/80 (11%)
PH_APBB1IP 295..417 CDD:269961 25/130 (19%)
PH 300..407 CDD:278594 23/115 (20%)
BPS 434..474 CDD:286088 9/40 (23%)
SH2_Grb10 495..602 CDD:198278 10/59 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.