DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and gab1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_017208591.1 Gene:gab1 ZFINID:ZDB-GENE-040426-2674 Length:770 Species:Danio rerio

Alignment Length:903 Identity:168/904 (19%)
Similarity:276/904 (31%) Gaps:303/904 (34%)


  Fly   417 GSATEDDD------NDTASK-----------QADSGIGEPAPSPSVSPEPEAEKSQQESSSEDDE 464
            |..:.|.|      ||.|.|           |.|:|:.            ..:|..:.|...|.:
Zfish    36 GRLSGDPDVLEYYKNDHAKKPIRVIDLNLCEQVDAGLS------------FNKKDLEHSFIFDIK 88

  Fly   465 AIKVYNFKLCQTSKKPEPSAATLAELTALTAQDIEEE---DNHVDQPASIT-----NGNLATPSS 521
            .|....:.:.:|.:........:.|:......|.|:.   .:||:.|..:.     :|.|.....
Zfish    89 TIDRIFYLVAETEEDMNKWVRNICEICGFNPTDTEDSAKVSHHVNVPGGLVVDMAPSGGLGGALG 153

  Fly   522 ETSLTSWNYLDPISPPPDFSDQQMQKRNAGSLSPGSPLDEIVDELATIINQQRLDTLIKKQPDPQ 586
            .::|.:       .|||   .|.:..|..||   .|.|||..|.| .::|.:      .|:|:| 
Zfish   154 ASALAN-------LPPP---YQPVSIRQLGS---SSSLDEPQDYL-WLLNCE------SKKPEP- 197

  Fly   587 MVEIESAKPNRLANFSITTAKSTTRIGRADSFQAGASGGGTE------VASSGRALSHRSSSHVS 645
                                         :|..|....|..|      .....|:.:|.|.:|..
Zfish   198 -----------------------------NSLVAPLCLGEEEQEYLLLEECESRSAAHDSQAHGD 233

  Fly   646 LNKLEQNGIGLGQRRSSSELSIGES-PSLQSPEVIKTILNSRKNSLAESGGSASTPV-----TEQ 704
            .:|           .:|||....:: ||..:|               .|..|.:.||     |:.
Zfish   234 CSK-----------STSSEPDCNDNLPSHYTP---------------TSSTSKNAPVNGFFSTQH 272

  Fly   705 PKIIKQLESLAKEQSSVD--GVKDISSSRSEASQQSPTPVPKKSNPGVEKPTSPTFRAVQEPYPS 767
            |..:.....|..:..|.|  |:..:..|.|    |....:||.:                    :
Zfish   273 PTGLYDSPPLRGQSLSADSQGLYHLPRSYS----QDTVLLPKSA--------------------T 313

  Fly   768 SPALQKSSPAVQEQRTSPVERPSLPPAVKSVEEQAVSLHQKEIVVQKESPPLESMKESFVIVSKM 832
            ||.:....|.......:|..:|||            ..|.:.:.|..:.||......::.:....
Zfish   314 SPPIPDGEPGELYVFNTPGRKPSL------------EAHLRNLSVSYDIPPTPGSNSTYQVPRTA 366

  Fly   833 SPPAV----KKVPDPFPKVEAVKEESSGNESSQSTITPPNTPATPVS----------PVN----- 878
            ...||    :.:|.|.|...:|...|...|.|     |.:|...|.|          |.:     
Zfish   367 GVEAVSGSTEVIPPPRPPKPSVSGGSVPPERS-----PTDTYVVPRSVSETDTNYCVPTSAGGNK 426

  Fly   879 -LRNPNNTMAEIEQS--QRDEPAPSSKPLPTTYRYSGPPSINFATWSERPKSTVAIKNEGDYIFG 940
             ||  :||:..::.|  ::|..:.....:|..:     ||....::..........||:|....|
Zfish   427 ALR--SNTIGTVDSSRLRKDYGSQDCYDIPRPF-----PSEKSCSFDFNESFNNYFKNKGMVPVG 484

  Fly   941 GAGKSQQLTSPPSKLTIGVASPILRMGIPQGKEYHVPITVKPLKDEILENQQQEKKEKPEVQELK 1005
            |....:.                        .|.:||::|..|..: ......|..::|....:.
Zfish   485 GVSTEEM------------------------DENYVPMSVHSLSHQ-RSGSLSEPIQEPNYVPMT 524

  Fly  1006 DQEIEKESVSVKV----------KPKTPVK---PVQKRIEKPLDQDQNSLQNHSSTLPRPAKSNR 1057
            ...:|..|:..:|          .||||.:   |:.:....|:  |:|...:.....|   |.||
Zfish   525 PGTVEFSSLGKQVPPPAHMGFRSSPKTPPRRPIPISECQPPPI--DRNLKPDRKGQSP---KINR 584

  Fly  1058 FTLPAAQNNQMVSHLTMNSLPRPVSSLERNRPVEANPAPAPFGQSTLRRTGFKERMLAKEQQEQE 1122
            .......::|.:...:.....:|.       |:|..|.                      .:.:|
Zfish   585 AVGLERTDSQTIGEFSRRRKVKPA-------PLEIKPV----------------------SEWEE 620

  Fly  1123 QALRIRVSVNESI---PSSAT-APKSPPESKPAPPSIS-------GYVALKSTKVEVKLQEPET- 1175
            ....:|..|..|.   ||..| ||:  |.|..:..|.|       .||.:::   .:...||.. 
Zfish   621 YTAPVRSPVTRSFTRDPSRFTVAPR--PSSGQSTASSSDSDECDENYVTMQA---NMSSDEPNKL 680

  Fly  1176 -KPVSLQVKLKPTVQPA-----------TTPSPPPPPPALQPVKTNGGRSGPTAPDPR 1221
             .|::......|.|:|.           ..|....||   :..|.||  :|.:|.|.|
Zfish   681 GAPMNADGGGSPMVKPKGDKQVEYLDLDLDPGKSTPP---RKKKNNG--TGISASDER 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 110/602 (18%)
gab1XP_017208591.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.