DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and apbb1ip

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_956928.1 Gene:apbb1ip ZFINID:ZDB-GENE-040426-1318 Length:646 Species:Danio rerio

Alignment Length:432 Identity:90/433 (21%)
Similarity:144/433 (33%) Gaps:123/433 (28%)


  Fly    19 KGKWPK-----NKSGTGNSSMGKLSKSSTQLHHLSTDTDINETSQLEYNRITPVPAATSNAPFEQ 78
            |..|.:     ..||...|..|| :|:|..|..|           ::::.:        |..:.:
Zfish   306 KKSWKQRYFLLRASGLYYSPKGK-TKASRDLVCL-----------VQFDNV--------NVYYCK 350

  Fly    79 TFRITVLLPKDQLFVARLGARVPLSKLLSLVCDNKQLDADKYEFRSPVDASQVYSCESTIGTVGL 143
            .:||....|.|..|:.:.......|:.:..:|.:.:...:.:                      :
Zfish   351 EYRIKYKAPTDHCFMLKHPQIQKESQYIKFMCCDDEWSMNLW----------------------V 393

  Fly   144 SEIRLC-HKSESYDNFNPDVMHKFQRTGVARDSLSSSSDFSSSRHSKVTAKTPSPYSSSNSLNS- 206
            :.||:. :..:.|||:...|          |.:..|:|..:.:..:..||.||||...:.:.|. 
Zfish   394 TGIRVAKYGKQLYDNYKAAV----------RKASGSASWANRTIQASSTASTPSPTPKAKAANGH 448

  Fly   207 ------MDSTGMNYTRTPVVVPPAKVLAPPPRKKRTAPRPPSQVCIPEQSVPDIPAANSKSEPAY 265
                  .:....|.:..|...|....|.|||......|.||:.   |....|.:|.:::|.. .:
Zfish   449 APQPPVENKVPSNQSSLPPPPPSMDFLPPPPPDPMFPPPPPAP---PAPPAPPVPVSSTKVN-KF 509

  Fly   266 AVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPPIAGGPEPTPRKRLLQI 330
            ....|.||                    |..|              .||:...|.|.|...:..:
Zfish   510 PPPPKFPQ--------------------SSFP--------------PPPMDDLPPPPPPPEIADL 540

  Fly   331 KKKTAPAPPPDFQS-GGDNISLASLPEPVTPTPNIPQPAPRITT------PLPIAPTANPPLAQV 388
            .....|.|||.|.| ||:::.    |.|..|..::|.|.|..|:      |.|..|....|...|
Zfish   541 PPDFLPPPPPSFVSHGGESLP----PPPPDPVASLPPPPPAFTSAGGAPPPPPPPPPPPAPAPAV 601

  Fly   389 NGNGNGSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASK 430
            |     :|.|:|.||    .|.|..|:..........|..|:
Zfish   602 N-----NPAGSVRKV----APPPPKRTTPQLAAPSGGDFMSE 634

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 17/66 (26%)
apbb1ipNP_956928.1 UBQ 172..246 CDD:294102
PH_APBB1IP 289..410 CDD:269961 24/146 (16%)
PH 296..401 CDD:278594 21/137 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.