DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Raph1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001102268.2 Gene:Raph1 RGDID:1308387 Length:1266 Species:Rattus norvegicus

Alignment Length:1217 Identity:241/1218 (20%)
Similarity:346/1218 (28%) Gaps:466/1218 (38%)


  Fly    86 LPKDQLFVARLGARVPLSKLLSLVCDNKQLD------ADKY--EFRSPVDA------SQVYSCES 136
            :||.:..|:|           .||| ..|||      ...|  ::::|.|.      .|:.....
  Rat   429 VPKGKAKVSR-----------DLVC-FLQLDHVNVYYGQDYRNKYKAPTDCCLALKHPQIQKKSQ 481

  Fly   137 TIGTVGLSEIRLCHK-----------SESYDNFNPDVMHKFQRTGVARD--SLSSSSDFSSSRHS 188
            .|..:...:.|..|:           .:.|.|:    ....:||..|.|  ||||||..|.|..|
  Rat   482 YIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNY----QEALKRTESAYDWTSLSSSSIKSGSSSS 542

  Fly   189 KVTAKTPSPYSSSNSLNSMDSTGMNYTRTPVVVPPAKVLAPPPRKKRTAPRPPSQVC-----IPE 248
            .:      |.|.||..|..|| |::.|     :|...:     |.:.|.....|:..     :.|
  Rat   543 SI------PESQSNHSNQSDS-GVSDT-----LPSGHI-----RSQSTVSSIFSEAWKRGTQLEE 590

  Fly   249 QSVPDIPAANSKSEPAYAVIVK--RPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDL 311
            .|...:.:.|.    :|..::.  .||..:.||                          |.....
  Rat   591 SSKARMESMNR----SYTSLMPPLSPQTKIITP--------------------------YTASQP 625

  Fly   312 KPPIAGGPEPTPRKRLLQIKKKTAPAPPPDF--QSGGDNISLASL---PEPVTPTPNIPQ----- 366
            .||:...|.|.|.      .....|.|||..  ||...:.|.|::   ...:|...|..|     
  Rat   626 SPPLPPPPPPPPP------PPPPPPPPPPPLPSQSAPSSGSAATMFVKYSTITRLQNAAQHSGTL 684

  Fly   367 ---PAPRITTPLPIAPTANPPLAQVNGNGNGSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTA 428
               |||....|||:|..:...:..       .|||    |:....|.|.|.:.|||         
  Rat   685 FKSPAPSAMQPLPLASQSKAQIVV-------PPNG----VIPPPPPPPPPPTPGSA--------- 729

  Fly   429 SKQADSGIGEPAPS-PSVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAELTA 492
              .|.......||| |..||:|              ..:|::..:....:..|.|.||.|...|.
  Rat   730 --MAQLKPVPCAPSLPQFSPQP--------------PPLKIHQVQHLPQAAPPTPPAAPLIPATV 778

  Fly   493 LTAQDIEEEDNHVDQPASITNGNLAT--PSSETSLTSWNYLDPI---SPPPDFSDQQMQKRNAGS 552
                           |.......|.|  ||:.|.:.|     |:   :.||              
  Rat   779 ---------------PPQAPPKPLVTIPPSASTKMVS-----PVVAQAVPP-------------- 809

  Fly   553 LSPGSPLDEIVDELATIINQQRLDTLIKKQPDPQMVEIESAKPNRLANFSITTAKSTTRIGRADS 617
             :|..|:..                 .||||...:..|....|.:      .|......:.:..|
  Rat   810 -TPAPPVPP-----------------TKKQPVFPVSHIPPTPPVQ------PTPHPPPTLPKQQS 850

  Fly   618 FQAGASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGESPSLQSPEVIKTI 682
            |                                                 |..|           
  Rat   851 F-------------------------------------------------GVKP----------- 855

  Fly   683 LNSRKNSLAESGGSASTPVTEQPKIIKQLESLAKEQSSVDGVKDISSSRSEASQ--QSPTPVPKK 745
                          ..:|::..|.::||:                      |||  ..|||.|..
  Rat   856 --------------PPSPLSPVPSVVKQM----------------------ASQFPPPPTPPPVD 884

  Fly   746 SNPGVEKPTSPTFRAVQEPYPSSPALQKSSPAVQEQRTSPVERPSLPPAVKSVEEQAVSLHQKEI 810
            |.|....|.|.|        |.||...|:.|..|.. :.|...|..||                 
  Rat   885 SQPLKPLPASVT--------PQSPPAVKAKPKWQPS-SIPAPSPDFPP----------------- 923

  Fly   811 VVQKESPPLESMKESFVIVSKMSPPAVKKVPDPFPKVEAVKEESSGNESSQSTITPPNTPATPVS 875
                  ||    .||.::.....|||....|.|.|                    ||..|..|||
  Rat   924 ------PP----PESSLVFPPPPPPAPVPPPPPPP--------------------PPPPPPPPVS 958

  Fly   876 PVNLRNPNNTMAEIEQSQRDEPAPSSKPLPTTYRYSGPPSINFATWSERPKSTVAIKNEGDYIFG 940
            |:....|:...:..:::.:.......||.||..|.|   ||...:.:|.|:.             
  Rat   959 PMASPTPDKGGSPGKKTSKMSSPGGKKPPPTPQRNS---SIKSGSCAEHPEP------------- 1007

  Fly   941 GAGKSQQLTSPPSKLTIGVASPILRMGIPQGKEYHVPITVKPLKDEI-LE-------NQQQEKKE 997
               |...:.|..||.     :|....|.| .||...|....|...:: |.       :||.....
  Rat  1008 ---KRPSVDSLVSKF-----APPAESGSP-SKETPPPPAAPPKPGKLHLSGVNLPGIHQQGILSA 1063

  Fly   998 KPEV--QELKDQEIEKESVSVKVKPKTPVKPVQKRIEKPLDQDQNSLQNHSSTLPRPAKSNRFTL 1060
            ||.|  ...||..:|..|                   .|.|.|          .|.|.......|
  Rat  1064 KPSVLSGRGKDAVVEFPS-------------------PPSDSD----------FPPPPPEIELPL 1099

  Fly  1061 PAAQNNQMVSHLTMNSLPRPVSSLERNRPVEANPAPAPFGQSTLRRTGFKERMLAKEQQEQEQA- 1124
            |..:            :|...|.....:....||.|..:.::::::.....|....:.....|| 
  Rat  1100 PPIE------------IPAVFSGNTSPKVAVVNPQPQLWSKTSVKKAPPPTRPKRNDSTRLTQAD 1152

  Fly  1125 LRIRVSVNESIPSSATAPKSPPESKPAPPSISGYVA-LKSTKVEVKLQEPETKPVSLQVKLKPTV 1188
            :..:.::...:|...|:|||....:|      |::| |..|.....:....:...|...:.:||.
  Rat  1153 ISEQPAMTTVVPQVPTSPKSSLSVQP------GFLADLNRTLQRKSITRHGSLSSSRMSRAEPTA 1211

  Fly  1189 QPATTPSPPPPPPALQPVKTNG------------GRSGPTAPDPRSQ 1223
            .......|||||..|...:..|            .|..|.||..|.|
  Rat  1212 TMDDMALPPPPPELLSDQQKAGFGGSHISGYATLRRGPPPAPPKRDQ 1258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 110/594 (19%)
Raph1NP_001102268.2 UBQ 270..351 CDD:294102
PH_APBB1IP 393..515 CDD:269961 19/102 (19%)
PH 398..506 CDD:278594 17/89 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.