DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Gab1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001101914.1 Gene:Gab1 RGDID:1311085 Length:694 Species:Rattus norvegicus

Alignment Length:679 Identity:135/680 (20%)
Similarity:211/680 (31%) Gaps:269/680 (40%)


  Fly    52 DINETSQLEYNRITPVPAATSNAPFEQTFRI------------TVLLPKDQLFVA------RLGA 98
            ||...:..|.:.:.|: |::|.||.:..|.|            :|.||.....::      .||.
  Rat   113 DICGFNPTEEDPVRPL-ASSSQAPADSPFAINTAPASAHMEPSSVALPPSYQLISLPPHPDTLGL 176

  Fly    99 RV-PLSKLLSLVCDNKQLDADKYEFRS------------------PVDASQ-------------V 131
            |. |...||.:.|.:|:.:..:..|.|                  |..:||             |
  Rat   177 REDPQDYLLLINCQSKKPEPTRAHFDSAKPTSSETDCNDNVPSHKPPASSQGKHGMNGFFQQQMV 241

  Fly   132 YSCESTIGTVGLSEIRLCHKSESYDNFNPDVMHKFQRTGVARDS--------LSSSSDFSSSRHS 188
            |.|.....|....|..|.:...||.:   ||:.|...:....|.        ..:||..:..||.
  Rat   242 YDCPPPRVTSVSGESGLYNLPRSYSH---DVLPKESPSSTEADGELYVFNTPSGTSSVEAQMRHV 303

  Fly   189 KVTAKTPS------------PYSSSNSLNSMDSTGMNYTRTPVVVPPAKVLAPPPRKKRTAPRPP 241
            .::...|.            |..:....:.:|:       .|.|.||.     ||:...|..|.|
  Rat   304 SISYDIPPTPGNTYQVPRTFPEGTLGQSSKLDT-------IPDVPPPR-----PPKPHSTHDRSP 356

  Fly   242 SQVCIPEQSVPDIPAANSKSEPAYAVIVKRPQLCM--STPNLSGPLEL----------DCNGNGS 294
            .:.|       .:|...|.::.:|.:    |...|  |..|....::|          ||.....
  Rat   357 VETC-------GVPRTASDTDSSYCI----PPAGMPPSRSNTISTVDLNKLRKDAGSQDCYDIPR 410

  Fly   295 KSPDE--DSTDGHYATLDLKPPIAGG---------------PEPTPRKRLLQIKKKTAPAPPPDF 342
            ..|.:  .|.:|.:..|.:|..:|.|               |...||.......:   |...|::
  Rat   411 TFPSDRSSSLEGFHNQLKIKNVLAAGNVSGEELDENYVPMNPNSPPRHHPSSFAE---PIQEPNY 472

  Fly   343 QSGGDNISLASLPEPVTPTP--------NIPQPA-----------PRITTPLPIAPTANPPLAQV 388
                         .|:||..        .:|.||           ||  .|:|:|....||:   
  Rat   473 -------------VPMTPGTFDFSAFGMQVPPPAHLGFRSSPKTPPR--RPVPVADCEPPPV--- 519

  Fly   389 NGNGNGSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGIGEPAPSP---------- 443
              :.|..|:..|....|...|..|...|              ||      |..||          
  Rat   520 --DRNLKPDRKVKPAPLEIKPLSEWEEL--------------QA------PVRSPITRSFARDSS 562

  Fly   444 --SVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAELTALTAQDIEEEDNHVD 506
              .:||.|::..|...||...|                                    .|:|:|.
  Rat   563 RFPMSPRPDSVHSTTSSSDSHD------------------------------------SEENYVP 591

  Fly   507 QPASITN--GNLATPSSETSLTSWNYLDPISPPPDFSDQQMQ----------------KRNAGSL 553
            ...:::|  .||...:|....:|     |::.|.  .|:|::                ::|:|| 
  Rat   592 MNPNLSNEDQNLFCNNSLEGASS-----PMTKPK--GDKQVEYLDLDLESGKSTPPRKQKNSGS- 648

  Fly   554 SPGSPL-DEIVDELATIINQQRLDTLIKK 581
              ||.: ||.||.:  :::||:  ||..|
  Rat   649 --GSSMSDERVDYV--VVDQQK--TLALK 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 50/242 (21%)
Gab1NP_001101914.1 PH_Gab1_Gab2 3..125 CDD:241297 3/12 (25%)
PH 6..115 CDD:278594 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.