DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and pico

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster

Alignment Length:657 Identity:131/658 (20%)
Similarity:201/658 (31%) Gaps:270/658 (41%)


  Fly     9 ATLNRWFG---------RKKGKWPKNKS----GTGNSSMGKLSKSSTQL---------------- 44
            |.||.:.|         |||.|.|.:.:    ..|:||:||..:|...|                
  Fly   537 ACLNLFHGHNVYTGLGWRKKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIR 601

  Fly    45 -----------HH-------LSTDTDINETSQLEYNRITPVPAATSNAPFEQTFRITVLLPKDQL 91
                       |.       ||.|..::::|.....|...:.:.:|..|                
  Fly   602 VCKYGKQLWDSHKSLLEDLCLSRDDAVSQSSFAASMRSESISSISSAVP---------------- 650

  Fly    92 FVARLGARVPLSKLLSLVCDNKQLDADKYEFRSP----VDASQVYSCESTIGTV----------- 141
              ::.|:   :|..:|.:.::......:....|.    .|.:..:..|.|.||:           
  Fly   651 --SQCGS---VSSAISSMSNSTSGRTSRASSSSSSGCLSDDNNAFDSEFTTGTIKRKPSMKPNLP 710

  Fly   142 ---------GLSEIRLCHKSESYDNFNPDVMHKFQRTGVARDSLSSSSDFSSSRHSKVTAKTPSP 197
                     .:.||.:| :|...|..:|      :|:|..           :.|||:        
  Fly   711 LTTMTRQLKEVGEITIC-ESAGGDASSP------ERSGTL-----------TRRHSR-------- 749

  Fly   198 YSSSNSLNSMDSTGM-NYTRTPVVVPPAKVLAPPPRKKRTAPRPPSQVCIPEQSVPDIPAANSKS 261
                  ..|.:|.|. ...|.|:.||.|.|:      |:|.|               :.:|:|.|
  Fly   750 ------RKSQESNGSGTLKRRPIAVPVATVV------KQTEP---------------MGSASSTS 787

  Fly   262 EPAYAVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTD---GHYATLDLKPPIAGGPEPTP 323
            ..:.:.....|.:|                  :|.|..||..   ....:||..||         
  Fly   788 SSSNSTPTPTPSIC------------------AKPPPGDSASLMCSSTLSLDSLPP--------- 825

  Fly   324 RKRLLQIKKKTAPAPPP------DFQSGGDNISLASLPEPVTP----TPNIPQPAPRITTPLPIA 378
                        |.|||      |....|..:||||||.|..|    ..|..:|:.. :||.|: 
  Fly   826 ------------PPPPPALDGSEDQDVYGSQLSLASLPPPPPPEDVLAMNYAEPSSP-STPTPM- 876

  Fly   379 PTANPPLAQVNGNGNGSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGIGE----- 438
               :.|:...|.||                      ||..|........|.|||..|:..     
  Fly   877 ---STPMIMPNSNG----------------------SLPPAVPAKPMKPAVKQAAGGLKAAPPYK 916

  Fly   439 -------PA--PSPSVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAELTALT 494
                   ||  |.|.:.|.|.|:|....:.|.     .:...|:|    .|||.....:..|.|:
  Fly   917 APPDYVGPALLPGPPLPPPPPAQKKVSFADSP-----VLLRRKMC----SPEPVLPQRSPSTTLS 972

  Fly   495 AQDIEEEDN---------------HVDQPASITNGNLATPSSETSLTSWNYLDPISPPPDF-SDQ 543
            ........:               .|.:.:|::||:    |||.:..........:||.|| .|.
  Fly   973 CHSSSSAGSAYQTYAPGPMLPPRADVARLSSLSNGS----SSEVTSPKRLQESASNPPRDFLKDL 1033

  Fly   544 Q--MQKR 548
            |  |:|:
  Fly  1034 QRVMRKK 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 46/210 (22%)
picoNP_608363.1 GRB7_RA 364..451 CDD:176382
PH_APBB1IP 489..614 CDD:269961 17/77 (22%)
PH 494..605 CDD:278594 16/68 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.