DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Cobll1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_006499773.1 Gene:Cobll1 MGIID:2442894 Length:1274 Species:Mus musculus

Alignment Length:1358 Identity:270/1359 (20%)
Similarity:451/1359 (33%) Gaps:472/1359 (35%)


  Fly    39 KSSTQLHHLSTDTDINETSQLEYNRITPVPAATSNAPFEQTFRITVLLPKDQLFVARLGARVPLS 103
            |.:|.:..|..:..|.:...|:..:.||:      .| |:|.|:.:...|.|..:.|:....||.
Mouse   145 KPNTPIGMLDVEKVILKPKSLDKKKPTPI------IP-EKTVRVVINFKKTQKTIVRVSPHAPLQ 202

  Fly   104 KLLSLVCDNKQLD------ADKYEFRSPVDASQVYSCESTIGTVGLSEIRLCHKSE-------SY 155
            .|..::|...:.|      ...|:.:.|:|.::      ::..:||.|:.....|.       |.
Mouse   203 DLAPIICSKCEFDPLHTVLLKDYQAQEPLDLTK------SLNDLGLRELYAMDISRAPSATAFSK 261

  Fly   156 DNF--------NPDVMHKFQRTGVARDSLSSSSDFSSSRHSK----VTAKTP-SPYSSSNSLNSM 207
            .:|        |||::.:.:..|:          ||..:.||    .||..| :|..|.:.    
Mouse   262 SSFQESCQISHNPDIVKEKENKGI----------FSFFQRSKKKREQTASAPATPLVSKHR---- 312

  Fly   208 DSTGMNYTRTPVVVPP--AKVLAPPPRKKRTAPRPPSQV-------------CIPEQ-SVPDIPA 256
                .::||:..:..|  :..|.....|||.||.||...             |:... ||.|...
Mouse   313 ----PSFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPTSQGAAQGQERRASCVERSTSVDDTDK 373

  Fly   257 ANSKSEPAYAVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPPIAGGPEP 321
            ::|:     |::|:           :|.|:|.....|:.|                         
Mouse   374 SSSE-----AIMVR-----------TGSLQLSSTSIGTSS------------------------- 397

  Fly   322 TPRKRLLQIKKKTAPAPP---PDFQSGGDNISLA---SLPEPVTPTPNIPQPAPRITTPLPIAPT 380
                  |:..|:.|||||   |..|:...|.::|   .|.:.:.|...:...:|           
Mouse   398 ------LKRTKRKAPAPPSKTPLAQTDERNSAMAHGLPLEDGIAPDSMLELSSP----------- 445

  Fly   381 ANPPLAQVNGNGNGSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGIGEPAPSPSV 445
                      .|..:|.|::....|:                        |....:.:|....|.
Mouse   446 ----------EGMSTPEGSLGPGFLS------------------------QEQCAVPKPPDEISE 476

  Fly   446 SP-EPEAEKSQQESSSEDDEAIKVYNFK--LCQTSKKPEPSAATLAELTALTAQDIEEEDNHVDQ 507
            .| .|||..:...|....|.:::..:.|  |.:.||.|..|                        
Mouse   477 GPGTPEAAVASLTSGVSSDYSLEEIDEKEELSEASKDPAGS------------------------ 517

  Fly   508 PASITNGNLATPSSETSLTSWNYLDPISPPPD----FSDQQMQKRNAGSLSPG------SPLDEI 562
             .|:.:.::|:.|::..:|       :...||    .||.:....:.|....|      .|...:
Mouse   518 -ISVKSPDIASASTDMRIT-------VEKDPDSALGISDGETSPSSKGKTQEGRSTEGQGPYHPV 574

  Fly   563 VDELATIINQQRLDTLIKKQPDPQMVEIESAKPNR---LANFSITTAKST----TRIGRADSFQA 620
            |..:.   |:.|:...||        ::::..||:   :.|..:..|.||    .|.|:.:    
Mouse   575 VGHIG---NEDRVSDSIK--------DMKTLGPNQESVVQNEIMVCATSTDYVKNRPGKME---- 624

  Fly   621 GASGGGTEVASSGRALSHRSSSHVSLNKLEQN-GIGLGQRRSSSELSIGESP----SLQSPEVIK 680
                  |.:...|.||  :.:|.:..::|..: ...:...:||.|..:..||    .|..|.|.|
Mouse   625 ------TTIEGEGEAL--KKASDMETDRLSGSPACRMDNVKSSRENHLTASPGPDQKLNQPGVEK 681

  Fly   681 TILNSRKNSLAESGGSASTPV------------TEQPKIIKQLE----SLAKEQSSVDGVKDISS 729
            |.:        :.....:||.            :..|:..:.::    |::.:.||......:::
Mouse   682 TKM--------QDAAIQATPARGTFDGNHEVSNSSDPRADETVQTSDGSISAQHSSASLQDSVNA 738

  Fly   730 SRSEASQQSPTPV----PKKS---NPGVEKPTSPTFRAVQEPYPSSPALQKSSPAVQEQRTSPVE 787
            ||...||.:.|.|    |:|.   ..|...|.||...:.:.|   :.:..|:.| :..|.::|..
Mouse   739 SREFRSQGTSTYVQDRLPEKEPACTYGNNVPLSPVDGSNKNP---AASYLKNFP-LYRQDSNPKP 799

  Fly   788 RPS------------------LPPAVKSVEE----QAVSLHQKEIVVQKESP-----PLESMKES 825
            :||                  :||  ||:|.    ::.::.:|:  .||..|     .:|:|.|:
Mouse   800 KPSNEITREYIPKIGMTTYKIVPP--KSLEMAKDWESEAMGRKD--DQKMLPVGQRHTIENMTET 860

  Fly   826 FVIVSKMSPPAVKK-----VPDPFPKVEAVKEESSGNE--------SSQSTIT-PPNTP------ 870
            .:   :...||..|     .||..||      .|||.|        |...|.| ||..|      
Mouse   861 SM---QTEVPATSKSSQQPQPDLKPK------PSSGTERHLHRTLSSPTGTETNPPKAPRVTTDT 916

  Fly   871 -ATPVSPVNLRNPNNTMAEIEQSQRDEPAPSSKPLPTTYRYSGPPSINFATWSERPKSTVAIKNE 934
             ..|.:| ||.:.||.:....:|:...|             ...||..|....:|.        .
Mouse   917 GTIPFAP-NLEDINNILESKFRSRASNP-------------QAKPSSFFLQMQKRA--------S 959

  Fly   935 GDYIFGGAGKSQQLTSP---PSKLTIGVASPILRMGIPQGKEYHVPITVKPLKDEILENQQQEKK 996
            |.|:...|.||.. |:|   |.:.||              ||......:.|.:.....:::....
Mouse   960 GHYVTSAAAKSVH-TAPGPAPKEPTI--------------KEVQRDPQLSPEQHPSSLSERTHSA 1009

  Fly   997 EKPEVQELKDQEIEKESVSVKVKPKTPVKPVQKRIE--------KPLDQDQNSLQNHSSTLPRPA 1053
            ..|.:.:..|..|:|.: .....|..| ||:..|.|        ||:...       :.|.|.|.
Mouse  1010 PLPNISKADDDIIQKPA-ETSPPPVAP-KPMTLRAETSPPPVFPKPMTLP-------AETSPPPV 1065

  Fly  1054 KSNRFTLPAAQNNQMVSHLTMNSLPRPVSSLERNR--PVEANPAPAPFGQSTLRRTGFKERMLAK 1116
            .....||||..:..:|       .|:|::......  ||.|.|...|..|.|             
Mouse  1066 FPKPMTLPAETSLPLV-------FPKPMTLRAETSPPPVAAKPVALPGSQGT------------- 1110

  Fly  1117 EQQEQEQALRIRVSVNESIPSSATAPKSPPESKPAPPSISGYVALKSTKVEVKLQEPETKPVSLQ 1181
                         |:|.....:..||:....|.|:|.:::  |..:|                 |
Mouse  1111 -------------SLNLKTLKTFGAPRPYSSSGPSPFALA--VVKRS-----------------Q 1143

  Fly  1182 VKLKPTVQPATTPSPPPPPPALQPVKTN-------GGRSG-------PTAPDPRSQLL 1225
            ...|...:.|:..|...||.|.|..||:       |.:.|       |...:..||:|
Mouse  1144 SFSKACPESASEGSSALPPAATQDEKTHTVNKPTVGSQHGDGDKQNNPVQNEHSSQVL 1201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 135/685 (20%)
Cobll1XP_006499773.1 UBQ 92..161 CDD:294102 4/16 (25%)
Cobl 176..252 CDD:286545 18/82 (22%)
Ehrlichia_rpt 319..874 CDD:118064 134/721 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.