DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Apbb1ip

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001094047.1 Gene:Apbb1ip RGDID:1304795 Length:664 Species:Rattus norvegicus

Alignment Length:741 Identity:144/742 (19%)
Similarity:233/742 (31%) Gaps:262/742 (35%)


  Fly   667 IGESPSLQSPEVIKTILNSRKNSLAESGGSASTPVTEQPKI----------IKQL-ESL-AKEQS 719
            :||| :....::..|:| ...:.|.:|.|..:.|..| ||.          .|.| ||| |.|..
  Rat     1 MGES-NEDIDQMFSTLL-GEMDLLTQSLGVDTLPPAE-PKPPREEFNFSVGFKDLNESLNALEDQ 62

  Fly   720 SVDG-----VKDIS-------SSRSEASQQSPTPVPKKSNPGVEKPTSP-------------TFR 759
            .:|.     |.|||       .::.|:||........:::.|  :.|:|             .:.
  Rat    63 DLDALMADLVADISEAEQRTIQAQKESSQNQGHSALLEASDG--QGTAPRGYGANAAAFDVSDYE 125

  Fly   760 AVQEPYPSSPALQKSSPAVQEQRTSPVERPSLPPAVKSVEEQAVSLHQKEIVVQKESPPLESMKE 824
            ....|.|:.|.|....|.           |..||...|.||:.......:|.:     .||.:||
  Rat   126 EALPPPPADPMLDLLPPP-----------PPPPPKPLSKEEEEALAKADKIKL-----ALEKLKE 174

  Fly   825 SFVIVSKMSPPAVKKVPDPFPKVEAVKEESSGNESSQSTITPPNTPATPVSPVNL---------- 879
            :          .|||:         |.:...|:.|::|.:......|..|.. ||          
  Rat   175 A----------KVKKL---------VVKVHMGDNSTKSLMVDERQLARDVLD-NLFEKTHCDCNV 219

  Fly   880 -----------------RNPNNTMAEIEQSQRDEPAPSSKPLPTTYRYSGPPSINFATWSERPKS 927
                             .:..|.:..:....||                   :.|...:.|:.:.
  Rat   220 DWCLYEIYPELQIERIFEDHENVVEVLSDWTRD-------------------TENRVLFLEKEEK 265

  Fly   928 TVAIKNEGDYIFGGAGKSQQLTSPPSKLTIGVASPILRMG-------IPQ----------GKE-- 973
            ....||..::.....||.::.::  .|:.......:|...       :|:          ||:  
  Rat   266 YAVFKNPQNFYLDNKGKKEKESN--EKMNAKNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSW 328

  Fly   974 ------------YHVPI-TVKPLKD----------EILENQQQEKKEKPEVQE---LKDQEIEKE 1012
                        |:||. ..|..:|          .|....|.:.|.|.....   ||..:|:||
  Rat   329 KRRYFLLRASGIYYVPKGKTKTSRDLACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKE 393

  Fly  1013 SVSVKVKPKTPVKPVQK-----RIEKPLDQDQNSLQNHSSTLPRPAKSNRFTLPAAQNNQMVSHL 1072
            |..:|.......:.:.:     ||.|   ..:....|:...:.|...::|:|           :|
  Rat   394 SQYIKYLCCDDARTLSQWVMGIRIAK---YGKTLYDNYQRAVARAGLASRWT-----------NL 444

  Fly  1073 TMNSLP-RPVSSL-----ERNRPV-EANPAPAPFGQSTLRRTGFKERMLAKEQQEQEQALRIR-- 1128
            ...:.| :|.:.|     :.|.|: :|.|:|.|..:.||.:|        :..::::|.|...  
  Rat   445 GTATTPAQPAAGLKTGTSQPNGPMPQAAPSPGPPLRETLTQT--------ETTKDEKQGLANHSP 501

  Fly  1129 -VSVNESIPSSATAPKSPPESK-------PA-PPSISGYVALKSTKVEVKLQEPETKPVSLQ--- 1181
             .|.....|.|:..|..||..:       || ||...|..:...|........|...|...:   
  Rat   502 GASRENHRPKSSLLPPPPPVRRSSDTCGSPALPPKAKGPGSCTFTAQPENFLPPPPPPPPQEDDN 566

  Fly  1182 -VKLKP---------------------TVQPATTPSPPPPPPALQ----------------PVKT 1208
             :.|.|                     ||:.:..|.||||||.|.                |.|.
  Rat   567 SMLLPPPPPLAYLDEPPDFVPPPPPPATVEDSALPPPPPPPPCLSQEMTKSSPLPAKKLPVPPKR 631

  Fly  1209 NGGRSGPTAP-----DPRSQLLDAIR 1229
            ...:..|.||     |..|.|:.|::
  Rat   632 QENQGLPGAPRNTEQDFMSDLMKALQ 657

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 67/355 (19%)
Apbb1ipNP_001094047.1 GRB7_RA 185..263 CDD:176382 12/98 (12%)
PH_APBB1IP 308..429 CDD:269961 23/124 (19%)
PH 312..420 CDD:278594 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.