DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and GRB10

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_016867518.1 Gene:GRB10 HGNCID:4564 Length:710 Species:Homo sapiens

Alignment Length:345 Identity:71/346 (21%)
Similarity:110/346 (32%) Gaps:121/346 (35%)


  Fly   602 SITTAKSTTRIGRADSFQAGASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELS 666
            |...|..|...|.....:||.:...|......|.||.....|             |...|:||.|
Human     3 SAVHAPGTAGAGPRSPTRAGGAHAATPCGQCCRPLSRLDRKH-------------GSIYSASEAS 54

  Fly   667 IGESPSLQSPEVIKTILNSRKNSLAESGGSASTPVTEQP--------------------KIIKQL 711
            .|...|....:      ::.:...|.:|....:.||..|                    :.:.|.
Human    55 SGNLQSSFGAD------HNAEQEAAAAGPVTGSSVTSSPVTGSQVLTWVLSVKPGWPPQQTVLQS 113

  Fly   712 ESLAKEQSSVDG-VKDISSS----RSEASQQSPTPVPKKSNPGVEKPTSPTFRAVQEPYPSSPAL 771
            :.|.::...::. |.|:::|    .|..|.||.|                           .|.|
Human   114 QLLTEDDVDLEALVNDMNASLESLYSACSMQSDT---------------------------VPLL 151

  Fly   772 QKSSPAVQEQRTSPVERPSLPPAVKSVEEQAVSLHQKEIVVQKESP----PLESMKESFVIVSKM 832
            |..    |..|:.|  |.|.||  :|::.| ||..|:   ||:..|    .:..::|........
Human   152 QNG----QHARSQP--RASGPP--RSIQPQ-VSPRQR---VQRSQPVHILAVRRLQEEDQQFRTS 204

  Fly   833 SPPAVKKVPDPFPKVEAVKEESSGNESSQSTITPPNTPATPVSPVNLRNPNNTMAEIEQSQRDEP 897
            |.||   :|:|||::        ....|...:||.:.|.             :.|..:|:::...
Human   205 SLPA---IPNPFPEL--------CGPGSPPVLTPGSLPP-------------SQAAAKQNRKSRA 245

  Fly   898 APSSK----------PLPTT 907
            ..||.          ||.||
Human   246 GDSSHHSLVLCHGTCPLSTT 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 71/346 (21%)
GRB10XP_016867518.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.