DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and GRB7

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001229371.1 Gene:GRB7 HGNCID:4567 Length:555 Species:Homo sapiens

Alignment Length:382 Identity:66/383 (17%)
Similarity:118/383 (31%) Gaps:98/383 (26%)


  Fly   317 GGPEPTPRKRLLQIKKKTAPAPPPDFQSGGDNISLASLPEPVTPTPNIPQPAPR-ITTPLP---- 376
            |..:|..|...:::..    :||          .|:|.||.:.|.|..|...|| ..||||    
Human    13 GSVKPLSRSDAMELDL----SPP----------HLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVK 63

  Fly   377 -----IAPTANPPLAQVNGNGNGSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGI 436
                 :.||....|.:........|:          .|.|.|                       
Human    64 RSQPLLIPTTGRKLREEERRATSLPS----------IPNPFP----------------------- 95

  Fly   437 GEPAPSPSVSP---EPEAEKSQQESSSEDDEAIKVYNFK-LCQTSKKPEPSAAT-LAELTALTAQ 496
             |....||.||   .|.:.:......:.....:|||:.. .|::.:....:.|. :.|:....|.
Human    96 -ELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAH 159

  Fly   497 DIEEE-------------DNHVDQPASITNGNLATPSSETSLTSWNYLDPISPPPDFSDQQMQKR 548
            .:.:|             :..::...|:.....|.|....|...:.        .:|:..::.|.
Human   160 ALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFR--------KNFAKYELFKS 216

  Fly   549 NAGSLSPGSPLDEIVDELATIINQQRLDTLIKKQPDPQM---VEIESAKPNRLANF--------S 602
            :..||.|...:...:|....|.::..:...:.....|::   :::..:.......|        .
Human   217 SPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGL 281

  Fly   603 ITTAKSTTRIGRADSFQAGASGGGTEVASSGRALSHRSSSH---VSLNKLEQNGIGL 656
            ..:.|.|::..|...:.|..:.....|.:.||.|....:..   |..|||.....||
Human   282 YYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGL 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 52/327 (16%)
GRB7NP_001229371.1 GRB7_RA 123..207 CDD:176382 12/92 (13%)
PH_APBB1IP 248..370 CDD:269961 16/92 (17%)
BPS 389..433 CDD:312490
SH2_Grb7 448..555 CDD:198276
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.