DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and GAB1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_016863455.1 Gene:GAB1 HGNCID:4066 Length:738 Species:Homo sapiens

Alignment Length:812 Identity:162/813 (20%)
Similarity:269/813 (33%) Gaps:236/813 (29%)


  Fly   461 EDDEA---IKVYNFKLCQ------TSKKPEPSAATLAELTAL-----TAQDIEEEDNH------- 504
            ::|.|   |::.:..|||      |..|.|...:.:.::..:     ...|.|||.|.       
Human    36 KNDHAKKPIRIIDLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICD 100

  Fly   505 ----------------------VDQPASITNGNLATPSSETSLTSWNYLDP---ISPPPDFSDQQ 544
                                  .|.|.:|   |.|.||::...:|.....|   |:.||......
Human   101 ICGFNPTEEDPVKPPGSSLQAPADLPLAI---NTAPPSTQADSSSATLPPPYQLINVPPHLETLG 162

  Fly   545 MQKRNAGSLSPGSPLDEIVDELATIINQQRLDTLIKKQPDP-----QMVEIESAKPNRLANFSIT 604
            :|:         .|.|.::     :||.|      .|:|:|     ..|..|..:...|.:|...
Human   163 IQE---------DPQDYLL-----LINCQ------SKKPEPTSQGSSFVSEEGEEYLLLEDFESK 207

  Fly   605 TAKSTTRIGRADSFQAGASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGE 669
            |....|   .|||    |....:|...:....||::.:. |.:|...||.       ..:..|.:
Human   208 TIPLQT---HADS----AKSTSSETDCNDNVPSHKNPAS-SQSKHGMNGF-------FQQQMIYD 257

  Fly   670 SPSLQSPEVIKTILNSRKNSLAESGGSASTPVTEQPKIIKQLESLAKEQSSVDG---VKDISSSR 731
            ||..::|..      |..:||.....|.|..|.  ||:       :...:..||   |.:..|..
Human   258 SPPSRAPSA------SVDSSLYNLPRSYSHDVL--PKV-------SPSSTEADGELYVFNTPSGT 307

  Fly   732 SEASQQ----------SPTP-----VPKKSNPGVEKPTSPTFRAVQEPYPSSPALQKSSPAVQEQ 781
            |....|          .|||     :|:....|....||........|.|..|   |..||   .
Human   308 SSVETQMRHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPP---KPHPA---H 366

  Fly   782 RTSPVERPSLPPAVKSVEEQAVSLHQKEIVVQKESPPLESMKESFVIVSKMSPPAVKK----VPD 842
            ..||||..|:|......:       ....:......|..|...|.|.::|:...|..:    :|.
Human   367 DRSPVETCSIPRTASDTD-------SSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPR 424

  Fly   843 PFPKVEAVKEESSGNESSQSTITPPNTPATPVSPVNL--RNPNNTMAEIEQSQRDEPAPSSKPLP 905
            .||...:...|...|......:....:.::.....|.  .|||:...: ..|...||...:..:|
Human   425 AFPSDRSSSLEGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQ-HSSSFTEPIQEANYVP 488

  Fly   906 TTYRYSGPPSINFATWSER--PKSTVAIKNEGDYIFGGAGKSQQLTSPPSKLTIGVASPILRMGI 968
            .|     |.:.:|:::..:  |.:.:..            :|...|.|...:.:....|      
Human   489 MT-----PGTFDFSSFGMQVPPPAHMGF------------RSSPKTPPRRPVPVADCEP------ 530

  Fly   969 PQGKEYHVPITVKPLKDEILENQQQEKKEKPEVQELKDQEIEK-ESVSV-------KVKP-KTPV 1024
                    |...:.||.:       .|.:.|::..||...:|: :|.::       |||| ...:
Human   531 --------PPVDRNLKPD-------RKGQSPKILRLKPHGLERTDSQTIGDFATRRKVKPAPLEI 580

  Fly  1025 KP------VQKRIEKPLDQDQNSLQNHSSTL---PRPAKSNRFTLPAAQNNQMVSHLTMNSLPRP 1080
            ||      :|..:..|:.:   |....||..   |||...:..|..:..::...:::.||     
Human   581 KPLPEWEELQAPVRSPITR---SFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMN----- 637

  Fly  1081 VSSLERNRPVEANPAPAPFGQSTLRRTGFKERMLAKEQQEQEQALRIRVSVNESIPSSATAPKSP 1145
                    |..::..|..||.::|  .|....|:..:..:|.:.|.:      .:.|..:.|...
Human   638 --------PNLSSEDPNLFGSNSL--DGGSSPMIKPKGDKQVEYLDL------DLDSGKSTPPRK 686

  Fly  1146 PESKPAPPSIS----GYV--------ALKSTK 1165
            .:|..:..|::    .||        |||||:
Human   687 QKSSGSGSSVADERVDYVVVDQQKTLALKSTR 718

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 115/574 (20%)
GAB1XP_016863455.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.