DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and COBLL1

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001265387.1 Gene:COBLL1 HGNCID:23571 Length:1233 Species:Homo sapiens

Alignment Length:1301 Identity:259/1302 (20%)
Similarity:427/1302 (33%) Gaps:396/1302 (30%)


  Fly    39 KSSTQLHHLSTDTDINETSQLEYNRITPVPAATSNAPFEQTFRITVLLPKDQLFVARLGARVPLS 103
            |.:|.:..|..:..|.:...|:..:.||:      .| |:|.|:.:...|.|..:.|:.....|.
Human   166 KPNTPIGMLEVEKVILKPKMLDKKKPTPI------IP-EKTVRVVINFKKTQKTIVRVSPHASLQ 223

  Fly   104 KLLSLVCDNKQLD------ADKYEFRSPVDASQVYSCESTIGTVGLSEI---------------- 146
            :|..::|...:.|      ...|:.:.|:|.::      ::..:||.|:                
Human   224 ELAPIICSKCEFDPLHTLLLKDYQSQEPLDLTK------SLNDLGLRELYAMDVNRATSVTVFSK 282

  Fly   147 ----RLCHKSESYDNFNPDVMHK---------FQRTGVARDSLSSSSDFSSSRHSKVTAKTPSPY 198
                ..|..|:     |.|:|.:         |||:...||.               ||..|   
Human   283 SSLQESCQISQ-----NLDIMKEKENKGFFSFFQRSKKKRDQ---------------TASAP--- 324

  Fly   199 SSSNSLNSMDSTGMNYTRTPVVVPP--AKVLAPPPRKKRTAPRPPSQVCIPEQSVP-DIPAANSK 260
             ::..:|....|   :||:..:..|  :..|.....|||.||.||...   .|||| |:      
Human   325 -ATPLVNKHRPT---FTRSNTISKPYISNTLPSDAPKKRRAPLPPMPA---SQSVPQDL------ 376

  Fly   261 SEPAYAVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDG--------HYATLDLKPPIAG 317
                 |.|.:||..|:                 .||...|.||.        ...:|.|....||
Human   377 -----AHIQERPASCI-----------------VKSMSVDETDKSPCEAGRVRAGSLQLSSMSAG 419

  Fly   318 GPEPTPRKRLLQIKKKTAPAPP---PDFQSGGDNISLASLPEPVTPTPNIPQPAPRITTP--LPI 377
            ...       |:..|:.||:||   |..||  |..|..:..:||...|  |..|....:|  |..
Human   420 NSS-------LRRTKRKAPSPPSKIPPHQS--DENSRVTALQPVDGVP--PDSASEANSPEELSS 473

  Fly   378 APTANPPLAQVNGNGNGSPNGNVSKVLLNRTP------TPEPRSLGSATEDDDNDTASKQADSGI 436
            ..|.:|        |..|.....:..|:..|.      ||| .::.|.|....:|.:.::.|.  
Human   474 PETFHP--------GLSSQEQCTAPKLMEETSVFECPGTPE-AAITSLTSGISSDYSLEEIDE-- 527

  Fly   437 GEPAPSPSVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAELTALTAQDIEEE 501
                 ...:|..|:.|.......|:|   |...:..:..|.|....||  |...:...:|:..||
Human   528 -----KEELSEVPKVEAENISPKSQD---IPFVSTDIINTLKNDPDSA--LGNGSGEFSQNSMEE 582

  Fly   502 DNHVDQPASITNGNLATPSSETSLTS--WNYLDPISPPPDFSDQQMQKRNAGSLSPGSPLDEIVD 564
                .|....|:|.  .|.|....||  ...:|.|             ||..||.|.   .|.|.
Human   583 ----KQETKSTDGQ--EPHSVVYDTSNGKKVVDSI-------------RNLKSLGPN---QENVV 625

  Fly   565 ELATIINQQRLDTLIKKQPDPQMVEIESAKPNRLANFSITTAKSTTRIGRADSFQAGASGGGTEV 629
            :...|:..:..:..:|.......:.:|....|...:..:....:                  :|.
Human   626 QNEIIVYPENTEDNMKNGVKKTEINVEGVAKNNNIDMEVERPSN------------------SEA 672

  Fly   630 ASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGESPSLQS---------------PEVI 679
            ..:..|:|:: .:|::.:.:....:.......:.:.:|..:||..|               .|.:
Human   673 HETDTAISYK-ENHLAASSVPDQKLNQPSAEKTKDAAIQTTPSCNSFDGKHQDHNLSDSKVEECV 736

  Fly   680 KTILN--SRKNSLAESGGSAST--PVTEQPKIIKQLES--LAKEQSSVDGVKDI------SSSRS 732
            :|..|  |.::|...|..|.:|  ....|..:|...|.  ..|:.....|..|:      ....|
Human   737 QTSNNNISTQHSCLSSQDSVNTSREFRSQGTLIIHSEDPLTVKDPICAHGNDDLLPPVDRIDKNS 801

  Fly   733 EAS--------QQSPTPVPKKSN----PGVEKPTSPTFRAVQEPYPSSPALQK--SSPAVQEQRT 783
            .||        :|...|.||.||    ..:.|....|::.|.   |.|..:.|  .|..::.:..
Human   802 TASYLKNYPLYRQDYNPKPKPSNEITREYIPKIGMTTYKIVP---PKSLEISKDWQSETIEYKDD 863

  Fly   784 SPVERPSLPPAVKSVEEQAVSLHQKEIVVQKESP--PLESMKESFVIVSKMSPPAVKKVPD---- 842
            ..:.........::|:|.|:......|   .|||  ||.::|....:.::...|:....||    
Human   864 QDMHALGKKHTHENVKETAIQTEDSAI---SESPEEPLPNLKPKPNLRTEHQVPSSVSSPDDAMV 925

  Fly   843 ----PFPKVEAVKEESSGNESSQSTITPPNTPATPVSPVNLRNPNNTMAEIEQSQRDEPAPSSKP 903
                |.||:            ::.|.|.|..|       ||...||    |.:|:....|.:::.
Human   926 SPLKPAPKM------------TRDTGTAPFAP-------NLEEINN----ILESKFKSRASNAQA 967

  Fly   904 LPTTYRYSGPPSINFATWSERPKSTVAIKNEGDYIFGGAGKSQQLTSPPSKLTIGVASPILRMGI 968
            .|:::         |....:|.        .|.|:...|.||..            |:|      
Human   968 KPSSF---------FLQMQKRV--------SGHYVTSAAAKSVH------------AAP------ 997

  Fly   969 PQGKEYHVPITVKPLKDEILENQQQEKKEKPEVQELKDQEIEKESVSVKVKPKTPVKPVQKRIEK 1033
                                         .|..:||.::|.|::.:....:..:|:..:...:.:
Human   998 -----------------------------NPAPKELTNKEAERDMLPSPEQTLSPLSKMPHSVPQ 1033

  Fly  1034 PL----DQDQNSLQNHSSTLPRPAKSNRFTLPAAQ-NNQMVSHLTMNSLPRPVSSLERNRPVEAN 1093
            ||    |.|... |..:...|.|......|:||:| :.|.:..|.....|||.||          
Human  1034 PLVEKTDDDVIG-QAPAEASPPPIAPKPVTIPASQVSTQNLKTLKTFGAPRPYSS---------- 1087

  Fly  1094 PAPAPFGQSTLRRTGFKERMLAKEQQEQEQALRI-----------RVSVNE--SIPSSATAPKSP 1145
            ..|:||..:.::|:    :..:||:.|...|..:           ..|||:  .||....:.|..
Human  1088 SGPSPFALAVVKRS----QSFSKERTESPSASALVQPPANTEEGKTHSVNKFVDIPQLGVSDKEN 1148

  Fly  1146 PESK-------PAPPSISGYVALKSTKVEVKLQEPETKPVSL---------QVKLKPTVQPATTP 1194
            ..:.       |.|.....:..::.:.:..:..:||....||         ..|||....|:.|.
Human  1149 NSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTI 1213

  Fly  1195 S 1195
            |
Human  1214 S 1214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 122/647 (19%)
COBLL1NP_001265387.1 UBQ 113..182 CDD:294102 4/16 (25%)
Cobl 197..275 CDD:286545 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.