DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Y37D8A.4

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_499670.1 Gene:Y37D8A.4 WormBaseID:WBGene00012546 Length:227 Species:Caenorhabditis elegans

Alignment Length:149 Identity:36/150 (24%)
Similarity:56/150 (37%) Gaps:31/150 (21%)


  Fly    28 GTGNSSMGKLSKSSTQLHHLSTDTDINETSQLEYNRITPVPA---ATSNAPFEQTFRITVLLPKD 89
            ||..:...|...|..:|..:..: ||:......:..:.|..|   ..||...:.:|.|:....|.
 Worm    90 GTRKAEKAKKFGSFEELSKVKLE-DIHRAQSWFFVDVDPKSAERILMSNGFSDSSFLISFFRQKY 153

  Fly    90 QLFVARLGARVPLSKLLSLVCDNK---------QLDADKYEFRSPVDASQVYSCESTIGTVGLSE 145
            .|.:.|      .:|:..||..|.         |||.|: .|::.|:.::.|       |...|.
 Worm   154 VLSIWR------KTKVEHLVIRNYQKKNGTMAFQLDIDR-SFKNLVELTEYY-------TKNKSY 204

  Fly   146 IRLC---HKSESYDNFNPD 161
            : ||   .|..|....|||
 Worm   205 V-LCTKLSKGVSRPRRNPD 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064
Y37D8A.4NP_499670.1 SH2 118..202 CDD:214585 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.