DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and mig-10

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001021248.1 Gene:mig-10 WormBaseID:WBGene00003243 Length:779 Species:Caenorhabditis elegans

Alignment Length:935 Identity:185/936 (20%)
Similarity:311/936 (33%) Gaps:275/936 (29%)


  Fly   416 LGSATEDDDNDTASKQADSGIGEPAPS--PSVSPEPEAEKSQQESSSEDDE---------AIKVY 469
            :.|..|:.|.:..|.:.|...||...|  .|:.|...:.......:.|.||         .::..
 Worm     1 MDSCEEECDLEVDSDEEDQLFGEKCISLLSSLLPLSSSTLLSNAINLELDEVERPPPLLNVLEEQ 65

  Fly   470 NF-KLCQTSKKPEPSAATLAELTALTAQDIEEEDNHVDQPASITNGNLATPSSETSLTSWNYLDP 533
            .| |:|...::.....|...|..|.||.|.|.:|     |..      .|.:.|.|:|...|   
 Worm    66 QFPKVCANIEEENELEADTEEDIAETADDEESKD-----PVE------KTENFEPSVTMDTY--- 116

  Fly   534 ISPPPDFSD-QQMQKRNAGSLSPGSPLDEIVDELATIINQQ--RLDTLIKKQPDPQMVEIESAKP 595
                 ||.| ..:|.|....:.|..|:|.:...:..|....  :||.|::        |:|:.:.
 Worm   117 -----DFPDPYPVQIRARPQVPPKPPIDTVRYSMNNIKESADWQLDELLE--------ELEALET 168

  Fly   596 NRLANFSITTAKSTTRIGRADSFQAGASGGGTE--VASSGRALSHRSSSHVSLNKLEQNGIGLGQ 658
                                   |..:|.||.:  :..||...|....:..|::.|..       
 Worm   169 -----------------------QLNSSNGGDQLLLGVSGIPASSSRENVKSISTLPP------- 203

  Fly   659 RRSSSELSIGESPSLQSPEVIKTILNSRKNSLAESGGSASTPVTEQPKIIKQLESLAKEQSSVDG 723
              ....||..::|  |.|:    :|:...|.|....|...         |..:.|.|...||.||
 Worm   204 --PPPALSYHQTP--QQPQ----LLHHHNNHLGYQNGIHQ---------ITSINSAASSCSSPDG 251

  Fly   724 VKDISSSRSEASQQ---------------------SPTPV-PKKSNPGVEKPTSPTFRAVQEPYP 766
            ......|.|..|..                     |||.| |:......|:..:...|       
 Worm   252 DSAFGDSSSTESSNNRCRNSAFSSNDSCRDSLNTPSPTQVSPRNGELNAEEAKAQKIR------- 309

  Fly   767 SSPALQKSSPAVQEQRTSPV-----------------ERPSLPPAVKSV-EEQAVSLHQKEIVVQ 813
              .||:|    ::|.:.:.:                 ||.::...:|.: |:..::|.:...:|:
 Worm   310 --QALEK----MKEAKVTKIFVKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIALMEDHCIVE 368

  Fly   814 KESPPL---------ESMKESFVIVSKMSPPAV--KKVPDPFPKVEAVKEESSGNESSQSTITPP 867
             |.|.|         |.:.|:..:..:.||..:  .:.||.:..:.                .|.
 Worm   369 -EYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFIS----------------RPE 416

  Fly   868 NTPATPVSPVNLRNPNNTMAEIEQSQR-------DEP-------------APSSKPLPTTYRYSG 912
            ....||.:..::..|:.....|:..|:       .||             :...|.....|....
 Worm   417 LYLLTPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVLR 481

  Fly   913 PPSINFATWSERP--KSTVAIKN-EGDYIFGGAGKSQQLTSPPSKLTIGVASPILRMGIPQ---- 970
            |..:.:|..|::|  |....:.| ..:.::.|.|..::..| |:...|.:....|:|...|    
 Worm   482 PSGLYYAPKSKKPTTKDLTCLMNLHSNQVYTGIGWEKKYKS-PTPWCISIKLTALQMKRSQFIKY 545

  Fly   971 --------GKEYHVPITVKPLKDEILENQQQEKKEKPEVQELKDQEIEKESVSVKVKPKTPVKPV 1027
                    .|::.|.:.:.....|:|||.::       ..:::.:.:...|........|.:..|
 Worm   546 ICAEDEMTFKKWLVALRIAKNGAELLENYER-------ACQIRRETLGPASSMSAASSSTAISEV 603

  Fly  1028 QKRIEKPLDQDQNSLQNHSSTLPRPAKSNRFTLPAAQNNQMVSHLTMNSLPRPVSSLERNRPVEA 1092
                       .:||.:|..|   |:        .|.:.|:.||: ||:...|:|...||:    
 Worm   604 -----------PHSLSHHQRT---PS--------VASSIQLSSHM-MNNPTHPLSVNVRNQ---- 641

  Fly  1093 NPAPAPFG-----QSTLRRTGFKERMLAKEQQE---QEQALRIRVSVNESIPSSATAPKSPPESK 1149
              :||.|.     ||...||..|..:...||..   :...|.:...|:.:..||.|.|:...:|.
 Worm   642 --SPASFSVNSCQQSHPSRTSAKLEIQYDEQPTGTIKRAPLDVLRRVSRASTSSPTIPQEESDSD 704

  Fly  1150 ---PAPPSISGYVALKSTKVEVKLQEPETKPVSLQVKLKPTVQPATTPSPPPPPPALQPVKTNGG 1211
               ||||.::..         :::..|.|.|       ||.....:..:|||||......|... 
 Worm   705 EEFPAPPPVASV---------MRMPPPVTPP-------KPCTPLTSKKAPPPPPKRSDTTKLQS- 752

  Fly  1212 RSGPTAPDPRSQLLDAIRNFKREDL 1236
             :.|.||....  |:|....:||.:
 Worm   753 -ASPMAPAKND--LEAALARRREKM 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 119/633 (19%)
mig-10NP_001021248.1 UBQ 325..404 CDD:294102 13/80 (16%)
PH_APBB1IP 452..575 CDD:269961 24/124 (19%)
PH 457..565 CDD:278594 18/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.