DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Grb10

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001357532.1 Gene:Grb10 MGIID:103232 Length:621 Species:Mus musculus

Alignment Length:334 Identity:67/335 (20%)
Similarity:110/335 (33%) Gaps:116/335 (35%)


  Fly   289 CNGNGSKSPDEDST----DG-HYATLDLKPPIAGGPEPTPRKRL-----LQIKKKTAPAPPPDFQ 343
            ||    ...|.|:.    || |.:.........|.|:.:||:::     :.|.::        .|
Mouse    16 CN----MQSDTDTAPLLEDGQHASNQGAASSSRGQPQASPRQKMQRSQPVHILRR--------LQ 68

  Fly   344 SGGDNISLASLPEPVTPTPNIPQPAPRIT-----TPLPIAPTANPP----------------LAQ 387
            .....:..||||.       ||.|.|.:|     :|..:||::.||                :..
Mouse    69 EEDQQLRTASLPA-------IPNPFPELTGAAPGSPPSVAPSSLPPPPSQPPAKHCGRCEKWIPG 126

  Fly   388 VNGNGNGS---------PNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGIGEPAPSP 443
            .|..|||.         |...:||  |.|.        |..|:     |.::.:........|:.
Mouse   127 ENTRGNGKRKIWRWQFPPGFQLSK--LTRP--------GLWTK-----TTARFSKKQPKNQCPTD 176

  Fly   444 SVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQTSKKPEPSAATLAE-LTALTAQDIEE------- 500
            :|:|......||.|......: :||::          |...:.:.| ||.:||:|:.:       
Mouse   177 TVNPVARMPTSQMEKLRLRKD-VKVFS----------EDGTSKVVEILTDMTARDLCQLLVYKSH 230

  Fly   501 --EDNH---------------VDQPASITNGNLATPSSETSLTSWNYL------DPISPPPDFSD 542
              :||.               ::....:.......||....|...||.      :|::..||...
Mouse   231 CVDDNSWTLVEHHPQLGLERCLEDHEIVVQVESTMPSESKFLFRKNYAKYEFFKNPVNFFPDQMV 295

  Fly   543 QQMQKRNAG 551
            ...|:.|.|
Mouse   296 NWCQQSNGG 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 46/242 (19%)
Grb10NP_001357532.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.