DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and Gab2

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_034378.2 Gene:Gab2 MGIID:1333854 Length:666 Species:Mus musculus

Alignment Length:839 Identity:162/840 (19%)
Similarity:259/840 (31%) Gaps:300/840 (36%)


  Fly   442 SPSVSPEPEAEKSQQESSSEDDEAIKVYNFKLCQ------TSKKPEPSAATLAELTA------LT 494
            |..:|.:|:..:..:...|:  :.:::.|..||:      |..|.|...:.:.::..      |.
Mouse    38 SGRMSGDPDVLEYYKNEHSK--KPLRIINLNLCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLV 100

  Fly   495 AQDIEEEDNHVDQPASITNGNLATPSSET--SLTSWNYLDPISPPPDFSDQQMQKRNAGSLSPGS 557
            |:...:.:..|.....|...|.|..|:::  :|:|.:: .|.|.|.:||..|...|...|.:|..
Mouse   101 AETEADMNKWVQSICQICGFNQAEESTDSLRNLSSASH-GPRSSPAEFSSSQHLLRERKSSAPSH 164

  Fly   558 PLDEIVDELATIINQQRLDTLIKKQPDPQMVEIESAKPNRLANFSITTAKSTTRIGRADSFQAGA 622
            .....:......::.....||....|. :.:.:......|..|            .|:.||..|.
Mouse   165 SSQPTLFTFEPPVSSHMQPTLSTSAPQ-EYLYLHQCISRRTEN------------ARSASFSQGT 216

  Fly   623 SGGGTEVASSGRALSHRSSSHVSLNKLEQ------NGIGLGQRRSSSELSIGESPSLQSPEVIKT 681
                            |..|..::.||.|      ||:| ||......|   ..||..:.| .|.
Mouse   217 ----------------RQKSDTAVQKLAQSNGHCINGVG-GQVHGFYSL---PKPSRHNTE-FKD 260

  Fly   682 ILNSRKNSLAESGGSASTPVTEQPKIIKQLESLAKEQSSVDGVKDISSSRSEASQQSPTPVPKKS 746
            .......|||..|.:                     :||:.|        ||...:........|
Mouse   261 STYDLPRSLASHGHT---------------------KSSLTG--------SETDNEDVYTFKMPS 296

  Fly   747 N-----------PGVEKPTSPTFRAVQEPYPSSPALQKSSPAVQ-----EQRTSPVERPSLPPAV 795
            |           ..::.||:| ..|.|  .|.:..|.|:..|:.     :...:|..||..|.  
Mouse   297 NTLCRELGDLLVDNMDVPTTP-LSAYQ--IPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPS-- 356

  Fly   796 KSVEEQAVSLHQKEIVVQKESPPLESMKESFVIVSKMSPPAVKKVPDPFPKVEAVKEESSGNESS 860
                             |.|:|...|:::        .||.                 |..:.|.
Mouse   357 -----------------QAETPQWGSIQQ--------RPPI-----------------SENSRSV 379

  Fly   861 QSTITPPNT-PATPVSPVNLRNPNNTMAEIEQSQRDEPAPSSKPLPTTYRYSGPPSINFATWSER 924
            .:||...|| ||.                  .:.|...|.|.:    ||.|....|...|:||..
Mouse   380 AATIPRRNTLPAM------------------DNSRLHRASSCE----TYEYPARGSGESASWSAE 422

  Fly   925 PKSTVAIKNEGDYIFGGAGKSQQLTSPPSKLTIGVASPIL----RMG-------IPQGKEYH--- 975
            |....|:           |:|...:|..:.:.:...|..|    |.|       ||.....|   
Mouse   423 PPGKTAV-----------GRSNSASSDDNYVPMNPGSSTLLAMERPGDNSQSVYIPMSPGPHHFD 476

  Fly   976 ---VPITVKPLKDEILENQQQEKKEKPEVQELKDQEIEKESVSVKVKPKTPVKPVQKRIEKPLDQ 1037
               .|.|..|:            ...|.    :..||:...|:..:||....||.      ||| 
Mouse   477 PLGYPSTALPI------------HRGPS----RGSEIQPPPVNRNLKPDRKAKPT------PLD- 518

  Fly  1038 DQNSLQNHSSTLPRPAKSNRFTLPAAQNNQMVSHLTMNSLP----RPVSS----------LERN- 1087
                |:|::.....|.||     |..::...::..|.||..    ||:|:          .|.| 
Mouse   519 ----LRNNTVIDELPFKS-----PVTKSWSRINSHTFNSSSSQYCRPISTQSITSTDSGDSEENY 574

  Fly  1088 ----RPVEANPAPAPFGQSTLRRTGFKERMLAKEQQEQEQALRIRVSVNESIPSSATA------- 1141
                .||.|:|.|:                                ..|...|..:|.       
Mouse   575 VPMQNPVSASPVPS--------------------------------GTNSPAPKKSTGSVDYLAL 607

  Fly  1142 ---PKSP-PESKPAPPSISGYVALKSTKVE-VKLQEPETKPVSLQVKLKPTVQPATTPS 1195
               |.|| |..||:..|::     ...||: |::.:.:|:.:...::....|:.::.||
Mouse   608 DFQPGSPSPHRKPSTSSVT-----SDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPS 661

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 105/553 (19%)
Gab2NP_034378.2 PH-like 6..128 CDD:302622 17/92 (18%)
PH 9..118 CDD:278594 14/82 (17%)
SH3-binding. {ECO:0000250} 348..355 3/7 (43%)
SH3-binding. {ECO:0000250} 499..508 2/9 (22%)
Plasmodium_Vir <546..>629 CDD:304908 22/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.