DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and GAB4

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_016884064.1 Gene:GAB4 HGNCID:18325 Length:575 Species:Homo sapiens

Alignment Length:763 Identity:146/764 (19%)
Similarity:238/764 (31%) Gaps:286/764 (37%)


  Fly   353 SLPEPVTPTPNIPQPAPRITTPLPIAPTANPPLAQVNGNGNGSPNGNVSKVL----LNRTPTPEP 413
            |||.| :|:..:..|.|           |..||:...|:|....:.....||    |.::| ||.
Human     2 SLPSP-SPSRELCPPDP-----------AFAPLSSWPGSGPAGGSTRSGHVLYSGWLRKSP-PEK 53

  Fly   414 R-------------SLGSATEDDD------NDTASK-----------QADSGIGEPAPSPSVSPE 448
            :             ..|..:.|.|      ||.:.|           |.|..:........:...
Human    54 KLRLFAWRKRWFILRRGQTSSDPDVLEYYKNDGSKKPLRTINLNLCEQLDVDVTLNFNKKEIQKG 118

  Fly   449 PEAEKSQQESS----SEDDEAIKVYNFKLCQ-TSKKPEPSAATLAELTA----LTAQDIEEEDNH 504
            ...:....|.:    :|..|.:..:...:|| ...:.|.|...|..:::    |.:...|...:|
Human   119 YMFDIKTSERTFYLVAETREDMNEWVQSICQICGFRQEESTGFLGNISSASHGLCSSPAEPSCSH 183

  Fly   505 VDQPASITNGNLATPSSETSLT-----SWNYLDPISPPP------DFSDQQMQKRNAGSLSPGSP 558
            ...|..      ..|:||..::     :|    ||..||      ..:.|:.:...:.|.|.||.
Human   184 QHLPQE------QEPTSEPPVSHCVPPTW----PIPAPPGCLRSHQHASQRAEHARSASFSQGSE 238

  Fly   559 LDEIVDELATIINQQRLDTLIKKQPDPQMVEIES-----------AKPNR-LANFSITTAKSTTR 611
            ...|:          |.:|.::.........::.           :||:: .|.|..:|.:....
Human   239 APFIM----------RRNTAMQNLAQHSGYSVDGVSGHIHGFHSLSKPSQHNAEFRGSTHRIPWS 293

  Fly   612 IGRADSFQAGASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGESPSLQSP 676
            :         ||.|.|..:.:|....:.:||    .|..|:|                       
Human   294 L---------ASHGHTRGSLTGSEADNEASS----GKYTQHG----------------------- 322

  Fly   677 EVIKTILNSRKNSLAESGGSASTPVTEQPKIIKQLESLAKEQSS-VDGVKDISSSRSEASQQSPT 740
                             ||:||.|.          ||:.:...| :.|...:..|.|.||:.|..
Human   323 -----------------GGNASRPA----------ESMHEGVCSFLPGRTLVGLSDSIASEGSCV 360

  Fly   741 PVPKKSNPGVEKPTSPTFRAVQEPYPSSPALQKSSPAVQEQRTSPVERPSLPPAVKSV--EEQAV 803
            |:    |||     |||.                                  ||||..  :.|.|
Human   361 PM----NPG-----SPTL----------------------------------PAVKQAGDDSQGV 382

  Fly   804 SLHQKEIVVQKESPPLESMKESFVIVSKMSPPAVKKVPDPFPKVEAVKEESSGNESSQSTIT--- 865
            .:            |:.|....|.::.           .|..::...::.|.|:|.....:.   
Human   383 CI------------PVGSCLVRFDLLG-----------SPLTELSMHQDLSQGHEVQLPPVNRSL 424

  Fly   866 PPNTPATPVSPVNLRNPNNTMAEIEQSQRDEPAPSSKPLPTTYRYSGPPSINFATWSERPKSTVA 930
            .||..|.| :|.|||| |..:.|:          |.|| |.|..:||......::.|:.|.||.:
Human   425 KPNQKANP-TPPNLRN-NRVINEL----------SFKP-PVTEPWSGTSHTFDSSSSQHPISTQS 476

  Fly   931 IKN-----EGD-YIF-----------GGAGKSQQLTSPPSKLTIGVASPILRMGIPQGKEYHVPI 978
            |.|     .|: |:|           ||...|    :||..               .|..::..:
Human   477 ITNTDSEDSGERYLFPQNPASAFPVSGGTSSS----APPRS---------------TGNIHYAAL 522

  Fly   979 TVKPLKDEILENQQQEKKEKPEVQELKDQEIEK---ESVSVKVKPKTP 1023
            ..:|.|..|......:|.:..:|...|.|.::|   |.:.::...:.|
Human   523 DFQPSKPSIGSVTSGKKVDYVQVDLEKTQALQKTMHEQMCLRQSSEPP 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 128/675 (19%)
GAB4XP_016884064.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.