DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and cobll1a

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_005165843.1 Gene:cobll1a ZFINID:ZDB-GENE-120215-171 Length:737 Species:Danio rerio

Alignment Length:871 Identity:159/872 (18%)
Similarity:263/872 (30%) Gaps:329/872 (38%)


  Fly    31 NSSMGKLSKSSTQLHHLSTDTDINETSQLEYNRITP-VPAATSNAPFEQTFRITVLLPKDQLFVA 94
            ||.:|.|......|....:|.          |:..| :|.|        |.|:.:...|....||
Zfish    69 NSMIGSLEFEKVVLQVKGSDD----------NKKKPHIPVA--------TVRLLINYKKSHKAVA 115

  Fly    95 RLGARVPLSKLLSLVCDNKQLDADKYEFRSPVDASQVYSCESTIGTVGLSEIRLCHKSESYDNFN 159
            |:...|||::|:..||:                     .||                      |:
Zfish   116 RVNPAVPLAELMPAVCE---------------------KCE----------------------FH 137

  Fly   160 PDVMHKFQRTGVARDSLSSSSDFSSSRHSKVTAKTPSPYSSSNSLNSMDSTGMNYTRTPVVVPPA 224
            ||.      |.:.|                 |.::..|...:.|||......:...:|.|     
Zfish   138 PDA------TVLLR-----------------TDQSEEPLDLTKSLNDYGIRELYAKQTKV----- 174

  Fly   225 KVLAPPPRKKRTAPRPPSQVCIPEQSVPDIPAANSK---SEPAYAVIVKRPQLCMSTPNLSGPLE 286
             |.|.||    :.|...::....||..| :...|.:   ::..:.:.:|..:......:.|.|..
Zfish   175 -VSADPP----SDPVSTNKGADEEQKTP-VKEKNHREKANKGFFGLFIKSKKTSEQAVDDSAPAS 233

  Fly   287 LDCNGNGSKSPDEDSTDG---HYATLDLKPPIAGGPEPTPRKRLLQIKKKTAPAPP-PDFQSGGD 347
            .:.||..:     |..:|   |:.     |.|...          ..||:.||.|| ...||...
Zfish   234 PELNGQCT-----DRVNGFNDHFL-----PTIPAD----------MSKKRRAPLPPMVASQSVAC 278

  Fly   348 NISLASLPEPVTPTPNIPQPAPRITTPLPIAPTANPPLAQVNGNGNGSPNGNVSKVLLNRTP--T 410
            ::.:...||        ..||.:           ..||::::...:.          |.||.  .
Zfish   279 DLQIKDFPE--------SDPAGK-----------QGPLSRISSTESS----------LKRTKRRA 314

  Fly   411 PEPRSLGSATEDDDN--------DTAS----------------------------KQADSGIGEP 439
            |.|...|||:...||        |.:|                            :|:.......
Zfish   315 PPPPCDGSASTKSDNKVEEAEGQDRSSDKHRAVISDRCPEFDKVMSEFAELLQEWRQSTPAYANS 379

  Fly   440 APSPSVSPE-----------PEAEKS-----QQESSSEDDEAIKVY---------NFKL---CQT 476
            :||.:..||           ||||..     |....|.:.|.:..:         :|:|   .||
Zfish   380 SPSSNQPPESPLGLYTCLHTPEAELKALPGCQLLRKSSEREGLATFTVVPQRRQLSFELPFTSQT 444

  Fly   477 SKKPE-PSA-ATLAELTALTAQDIEEEDNHVDQPAS-------ITNGNLATPSSETSLTSWNYLD 532
            ::.|| |.. :|:...|.:..:..|.|  |:.:...       :.|||         |....|: 
Zfish   445 NQSPEHPEIHSTVRVETQIFTRTYESE--HLIEAGENSQVGMCVKNGN---------LNEHQYI- 497

  Fly   533 PISPPPDFSDQQMQKRNAGSLSPGSPLDEIVDELATIINQQRLD--------------TLIKKQ- 582
                .|:....:..|.....|..|..|:.:....:.:..::|||              :.:::: 
Zfish   498 ----YPELKSWERSKEAKKRLKRGQNLERLDSRRSNLDLEERLDGRSLADWSAIDFHTSHVEQEE 558

  Fly   583 -PDPQMVEIESAKPNRLANFSITTAKSTTRIGRADSFQAGASGGGTEVASSGRALSHRSSSHV-- 644
             .:|.:||.|..| :.:..|.          .|...|......|..::...||.....:|:.|  
Zfish   559 IEEPDLVESEEEK-DWVEEFK----------ERRMRFLGSHDDGIKKLDVWGRIQKEFTSTQVFW 612

  Fly   645 -------SLNKLE----QNGIGLGQRRSSSELSIGESPSLQSPEVIKTILNSRKNSLAESGGSAS 698
                   ..:|||    ...:.....|..|:..:........|....|:.|.:.||         
Zfish   613 DEDSREHEEDKLEMQICNENLTNFHLRMDSKTKLAAYSYYGKPGAHSTLTNIQPNS--------- 668

  Fly   699 TPVTEQPKIIKQLESLAKEQSSVDGVKDIS--SSRSEASQQSPTPVP---------KKSNPGVEK 752
                          |.||...|......::  ||:|.:..:|..|:.         ||:.     
Zfish   669 --------------SCAKNNFSFTSEAHLNTLSSKSHSGFESRPPIQLSLFAMAVFKKAK----- 714

  Fly   753 PTSPTFRAVQEPYPSSPALQKSSPAV 778
                .|:.|.:|   ||..::..||:
Zfish   715 ----CFKPVFDP---SPVRRRELPAL 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 92/523 (18%)
cobll1aXP_005165843.1 TGS 13..78 CDD:330245 4/9 (44%)
Cobl 100..169 CDD:312839 24/135 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.