DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and grb7

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_002940418.2 Gene:grb7 XenbaseID:XB-GENE-855910 Length:615 Species:Xenopus tropicalis

Alignment Length:536 Identity:99/537 (18%)
Similarity:173/537 (32%) Gaps:176/537 (33%)


  Fly   346 GDNISLASLPEPVTPTPNIPQPAPRITTPLPIAPTANPPLAQVNGNGNGSPNGNVSKVLLNRTPT 410
            ||::.|.:|....:|.|:........|:..|.|...:|..|::.     ||:...|:.||.::  
 Frog    81 GDDMDLEALESNHSPAPDNLYEREGCTSRCPTAQQGHPEKAELL-----SPDLKRSQPLLIQS-- 138

  Fly   411 PEPRSLGSATEDDDNDTASKQADSGIGEPAP-----SPSVSPEPEAEKSQQESSSEDDEAIKVYN 470
               |..| ...|:::.:||.   ..|..|.|     ||.::..|.. :|.:|..   ...:|||:
 Frog   139 ---RKWG-RLRDEESRSASL---PDIPNPFPELCNSSPILNNTPSG-RSPKEGG---PHVVKVYS 192

  Fly   471 FKLCQTSKKPEPSAATLAELTA-LTAQ---DIEEEDNHVDQPASITNGNLATPSSETSLTSWNYL 531
                      |.......|:|| .||:   |:..|..|.                 .|..||:.:
 Frog   193 ----------EDGTCRSLEVTAGATARHVCDMLVERVHC-----------------LSDESWSLM 230

  Fly   532 DPISPPPDFSDQQMQKRNAGSLSPGSPLDEIVDELATIINQQRL-----DTLIKKQPDPQMVEIE 591
            :                    |.|...|:..:::..:::..|.:     |:....:.:....|:.
 Frog   231 E--------------------LHPHLGLERCLEDHESVVEVQAMWPVGGDSNFIFRKNFAKYELF 275

  Fly   592 SAKPNRLANFSITTAKSTTRIGRADSFQAGASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGL 656
            ...|..|                   |.....||..|   :.:.|:|        ::|.||.:..
 Frog   276 RGSPYAL-------------------FPEDMVGGNLE---AQKGLTH--------SELVQNFLNS 310

  Fly   657 GQ-------------------------RRSSSELSI-GESPSLQSPEVIKTILNSRKNSLAESGG 695
            |.                         |||....|. |.|...:..:....:..|....|.:...
 Frog   311 GSWPEIQGYLHMKESSRKVWKRFFFFLRRSGLYYSTKGTSKDPRHLQYFADVNESNLYCLTQGKK 375

  Fly   696 SASTPVTEQPKIIKQLESLAKEQSSVDGVKDISSSRSEA-----------------------SQQ 737
            ..|.| ||....:|.|    |.:|...|:|.:.:...:|                       |::
 Frog   376 MYSAP-TEFGFCLKPL----KTRSGTKGLKILCTEDEQARTCWLTAIRLFKYGAQLYKNYQISKR 435

  Fly   738 SPTP--VPKKSNPGVEKPTSP------TFRAVQEPYPS-SPALQKSSPAVQEQRTSPVERPSLPP 793
            :|..  .|.|.....:....|      |.|.::.|..: |.||:::    |..|.....|.|||.
 Frog   436 NPRSWGEPPKQRSASDSTLVPMDFSGCTGRVIENPLEALSVALEEA----QSWRKKTTHRYSLPT 496

  Fly   794 AVKSVEEQAVSLHQKE 809
            ..::....:.::|:.:
 Frog   497 PCQATPPNSAAIHKSQ 512

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 93/511 (18%)
grb7XP_002940418.2 GRB7_RA 185..268 CDD:176382 20/130 (15%)
PH_APBB1IP 309..431 CDD:269961 20/127 (16%)
PH 314..422 CDD:278594 19/113 (17%)
BPS 448..492 CDD:286088 10/48 (21%)
SH2_Grb7 508..615 CDD:198276 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.