DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and grb14

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_021334741.1 Gene:grb14 ZFINID:ZDB-GENE-120313-3 Length:484 Species:Danio rerio

Alignment Length:184 Identity:36/185 (19%)
Similarity:63/185 (34%) Gaps:64/185 (35%)


  Fly   116 DADKYEFRSPVDASQVYSCESTIGTVGLSEIRLCHKSESYDNFNPDVMHKFQRTGVARDSLSSSS 180
            |:|.|...|   |.:||...:..|        .|.|:              .::..|||.....:
Zfish   236 DSDVYTLLS---AKKVYGAPTDYG--------FCVKA--------------SKSSSARDLKLLCA 275

  Fly   181 DFSSSRHSKVTA----------------------KTPSPYSSSNSLNSMDSTGMNYTRTPVVVPP 223
            |...:|...|||                      .:|....|.|||.::|.:|   .:|.|:..|
Zfish   276 DDEQTRTCWVTAMRLFKYGMQLYQNFIQPYQKQKSSPMRSISENSLVAIDFSG---HKTRVIENP 337

  Fly   224 AKVLAPPPR-----KKRTAPRPPSQVCIPEQSVPDIPAANSKSEPAYAVIVKRP 272
            ::.|:....     ::::..|..|.         ..|:|:..|..:.|:.:.:|
Zfish   338 SEALSVAVEEGLSWRRKSCHRLSSH---------GSPSASQSSMSSIAIHMAQP 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064
grb14XP_021334741.1 UBQ 99..>151 CDD:320785
PH_APBB1IP 181..301 CDD:269961 18/90 (20%)
BPS 315..359 CDD:312490 11/47 (23%)
SH2_Grb14 377..484 CDD:198277 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.