DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and cobll1b

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001352143.1 Gene:cobll1b ZFINID:ZDB-GENE-120313-6 Length:1089 Species:Danio rerio

Alignment Length:1261 Identity:240/1262 (19%)
Similarity:383/1262 (30%) Gaps:485/1262 (38%)


  Fly    77 EQTFRITVLLPKDQLFVARLGARVPLSKLLSLVCDNKQLDADKYEFRSPVDASQVYSCESTIGTV 141
            |.|.|:.:...|.|..:.|:..||||.:||..:|...:.|.........|.:........::...
Zfish   168 EATVRLVINYRKTQKTILRVSPRVPLRELLPAICQKCEFDPQTTLLSPSVQSEDTLDLSGSLNDF 232

  Fly   142 GLSEIRLCHKSESYDNFNPDVMHKFQRTGVARDSLSSSSDFSSSRHSKVTAKTPSPYSSSNSLNS 206
            ||.|:                        .|||:                 :..||.|..     
Zfish   233 GLREV------------------------YARDT-----------------RVISPVSPI----- 251

  Fly   207 MDSTGMNYTRTPVVVPPA------------KVLAPPPRKKRTAPRPPSQVCIPEQSVPDIPAANS 259
                      :||.:||:            |.|.....|:|.:..........|||:       :
Zfish   252 ----------SPVSLPPSPTRSEIFYHGKEKSLREKDNKRRFSLFRRGSKKQSEQSM-------T 299

  Fly   260 KSEPAYAVIVKRPQLCMSTPNLSGPLELDCNGNGSKSPDEDSTDGHYATLDLKPPIAGGPEPTPR 324
            .|.||..|..|:..:.||:.:...||..|||                 |:         |..|| 
Zfish   300 VSAPASPVHRKQRPVSMSSFSTHVPLSYDCN-----------------TM---------PSDTP- 337

  Fly   325 KRLLQIKKKTAPAPPPDFQSGGDNISLASLPEPVTPTPNIPQPAPRITTPLPIAPTANPPLAQVN 389
                  ||:.||.||        ::...|:|..::.|.....|                     :
Zfish   338 ------KKRRAPLPP--------SMMSQSMPSDLSQTQTTVHP---------------------D 367

  Fly   390 GNGN-------GSPNGNVSKVLLNRTPTPEPRSLGSATEDDDNDTASKQADSGIGEPAPSPSVSP 447
            ||.|       .|...:..|....|...|.|..:.:.|...|. |.|...:|.:..|.       
Zfish   368 GNQNLSSLSRASSTESSFKKSSTKRKAPPPPVMISTDTTHQDT-TDSSMTESAVTSPL------- 424

  Fly   448 EPEAEKSQQESS-----SEDDEAIKVYNFKLCQTSKKPEPSAATLAELTALTAQDIEEEDNHVDQ 507
              |..|.|:|.|     :.:||.:                                 |:::.::.
Zfish   425 --EEIKEQEEMSVGAGVNVEDETL---------------------------------EDNSSLNM 454

  Fly   508 PASIT----NGNLATPSSETSLTSWNYLDPISPPPDFSDQQMQKRNAGSLSPGSPLDEIVDELAT 568
            .|:|:    ....||||.: |:|                          |..|:|.|:.|.:|:|
Zfish   455 SANISLDSGRAGTATPSQD-SVT--------------------------LESGTPRDDPVCDLST 492

  Fly   569 -------IIN------QQRLDTLIKKQPDPQMVEIESAKPNRLANFSITTAKSTTRIGRADSFQA 620
                   .:|      |.|...:..:..||                           |:.:..  
Zfish   493 DAEVAEGTVNGEMKADQTRSSHITSEDKDP---------------------------GKTEQL-- 528

  Fly   621 GASGGGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSI---GESPSLQSPE----- 677
                  .:.:.||..|...:.|:.||.:..:.||    :.|.::|.:   ....::.|||     
Zfish   529 ------IQPSESGPVLEEVTVSNTSLPQRSECGI----QTSQTDLQVQCFDSDTAISSPESSCSI 583

  Fly   678 -----VIKTILNSRKNSLAESGGSASTPVTEQPKIIKQLESLAKE--QSSVDGVKDISSSRSEAS 735
                 ..|||.|:  :||..:........:.:|      .||..|  .|::...||:::|..|. 
Zfish   584 YAEAQTSKTIPNT--SSLTHTETQTQVQSSNEP------SSLCTEFSTSTIGLKKDMATSTDEL- 639

  Fly   736 QQSPTPVPKKSNPGVEKPTSPTFRAVQEPYPSSPALQKSSPAVQEQRTSPVERPSLPPAVKSVEE 800
              .|:....|......||.|.::....||.| .|:.:.:             |..:|        
Zfish   640 --QPSIQQSKDLTSTSKPASVSYVTDAEPKP-KPSNEHT-------------RGYIP-------- 680

  Fly   801 QAVSLHQKEIVVQKESPPLESMKESFVIVSKMSPPAVKKVPDPFPKVEAVKEESSGN-------- 857
             .|.:....||.||....|.|::....:.               |||:.....|:|.        
Zfish   681 -KVGMTTYTIVPQKSLEKLHSLEIEMTLE---------------PKVDCKPNVSNGTVTLNGHQN 729

  Fly   858 ---ESSQSTITPPNTPATPVSPVNLRNPNNTMAEIEQSQRDEPAPSSKPLPTTYRYSGPPSINFA 919
               :::|.| :||.|.:|.:|......|.:..|....|.....:.|:.|   ||..:.|     .
Zfish   730 AFAQTNQCT-SPPATNSTNLSTNLSTKPTSLSANTTYSSTKPTSSSTSP---TYLSTNP-----T 785

  Fly   920 TWSERPKSTVAIKNEGDYIFGGAGKSQQLTSPPSKLTIGVASPILRMGIPQGKEYHVPITVKPLK 984
            .||..|     |.:.....:.....|...|:|.:..|                            
Zfish   786 NWSTNP-----INSSTSPTYLSTNPSNSSTNPTNSST---------------------------- 817

  Fly   985 DEILENQQQEKKEKPEVQELKDQEIEKESVSV---KVKPKTPVKPVQKRI--EKPLDQD--QNSL 1042
                  :|......|......|:.|  :|||:   ||.|.|..||...|:  .|.:..|  .::.
Zfish   818 ------KQTNSSTNPTNSSSVDERI--DSVSLKDKKVPPATRPKPASFRVPQHKRMSGDYVSSAA 874

  Fly  1043 QNHSSTLPRPAKSNRFTLPAAQNNQMVSHLTMNSLPRPVSSLERNRPVEANPAPAPFGQSTLRRT 1107
            ...:|.....:.|:..:.|||:..:.:|....:..|          .:|..|.|.|..|      
Zfish   875 VRRASIGSSSSSSSCCSSPAARPKESLSSPQSDVFP----------AMEIFPPPPPPVQ------ 923

  Fly  1108 GFKERMLAKEQQEQEQALRIRVSVNESIPSS-ATAPKSPPES----------------------- 1148
                   .:|:|.|..:.: .:..||.|.:: ..|||.||.|                       
Zfish   924 -------WEEEQSQSTSAK-SLPQNEEIDAALPEAPKIPPSSFLSRQKSLPTNPAPSLSLEKLRS 980

  Fly  1149 ----KP-APPSISGYVALKSTKVE--------VKLQEPETKPVSLQVKLKPTVQPATTPSPPPPP 1200
                || :|.|.|.:....|:.|:        ..:||..|..::.|..::        .||.|| 
Zfish   981 FAAPKPYSPSSPSRFAQAVSSAVKRSQSLSHHAPVQETRTHTLTKQRPIR--------ESPEPP- 1036

  Fly  1201 PALQPVKTNGGRSGPTAPDPRSQLLD 1226
              ...|..||.|      :|.:|..|
Zfish  1037 --TSTVADNGDR------EPETQTAD 1054

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 117/641 (18%)
cobll1bNP_001352143.1 TGS 81..138 CDD:330245
Cobl 168..243 CDD:312839 21/116 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.