DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and grb10

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:XP_012819769.1 Gene:grb10 XenbaseID:XB-GENE-485564 Length:591 Species:Xenopus tropicalis

Alignment Length:571 Identity:108/572 (19%)
Similarity:182/572 (32%) Gaps:198/572 (35%)


  Fly   695 GSASTPVTEQPKIIKQLESLAKE-QSSVDGVKDISSSRSEA------SQQSPTPVPKKSNPGVEK 752
            |..|..::..|.....||:|..: .||:|.:....:|.||:      .|.:.:.:|   |.|...
 Frog    34 GFTSKRISLNPDDDVDLEALVNDMNSSLDNLYSTCTSVSESVPLLKNGQLNRSQLP---NSGTNS 95

  Fly   753 -PTSPTFRAVQEPYP-----------------SSPALQKSSPAVQEQRTSPVERP-SLP------ 792
             |:.|..:.:|...|                 |.||:....|.:....:|||..| |||      
 Frog    96 LPSMPHKQKLQRSQPMHIHAVRRLQEEQLRTSSLPAIPNPFPELCTPASSPVLVPGSLPQNQPVG 160

  Fly   793 --PAVKSVEEQAVS------------------LHQKEIVVQK-----ESPP---LESMKESFVIV 829
              ..||...|...|                  ::|...|...     |..|   ||...|...:|
 Frog   161 KKSVVKVFSEDGTSKVVEILADMTARDFCQLLVYQSHCVDDNSWTLVEHHPHLGLERCLEDHEMV 225

  Fly   830 ----SKMSPPAVKKVPDPFPKVEAVKEESSGNESSQSTITPPNTPATPVSPVNLRNPNNTMAEIE 890
                |.||..:.......:.|.|..|                       :|||. .|...:|..:
 Frog   226 VHVQSMMSSESKFLFRKNYAKYEFFK-----------------------NPVNF-FPEQMVAWCQ 266

  Fly   891 QSQRDEPAPSSKPLPTTYRYSGPPSI---------NFATWSERPKSTVAIKNEGDYIFGGAGKSQ 946
            ||  :...|.|:.|......:..|.|         ...:|.   |..|.::..|.|.     .::
 Frog   267 QS--NGSIPQSQLLQNFLNANSCPEIQGFLYVKEVGKKSWK---KLFVCLRRSGLYC-----STK 321

  Fly   947 QLTSPPSKLTIGVA----SPILRMGIPQGKEYHVP----ITVKPLKDEILENQQQEKKEKPEVQE 1003
            .::..|..|. |::    |.|..: |...|.|:.|    ..|||            .|.:.||:|
 Frog   322 GMSKEPRHLQ-GISDLEDSNIYSL-ISCKKLYNAPTDFGFCVKP------------NKVRNEVKE 372

  Fly  1004 LK-----DQE-----------------------IEKESVSVKVKPKTPVKPVQKR---------- 1030
            |:     |::                       |.::..|:.....|||:.|.:.          
 Frog   373 LRFLCAEDEQSRTCWMTAFRLLKYGMLLYQNYRIPQQKKSLHTNFSTPVRSVSENSLVAMDFSGQ 437

  Fly  1031 ----IEKPLDQDQNSLQNHSSTLPRPAKSNRFTLPAAQNN------QMVSHLTMNSLPRPVSSLE 1085
                ||.|::....:::...:...|   |:|..:..:|:.      ..|.|.|.:.....:|..|
 Frog   438 TGRVIENPVEAQSAAMEEGHAWRKR---SSRLNVLGSQSPLHPSTLSTVIHRTQHWFHGRISREE 499

  Fly  1086 RNRPVEANPAPAPFGQSTLRRTGFKERM-LAKEQQEQEQALRIRVSVNESI 1135
                          .|:.:::.|..:.: |.::.|...:|..:.:..::.|
 Frog   500 --------------SQTIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKI 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 68/336 (20%)
grb10XP_012819769.1 GRB7_RA 161..243 CDD:176382 15/82 (18%)
PH_APBB1IP 283..405 CDD:269961 25/144 (17%)
PH 288..396 CDD:278594 25/130 (19%)
BPS 423..464 CDD:286088 6/44 (14%)
SH2_Grb10 484..591 CDD:198278 10/68 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.